NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10087837

Scaffold Draft_10087837


Overview

Basic Information
Taxon OID3300000568 Open in IMG/M
Scaffold IDDraft_10087837 Open in IMG/M
Source Dataset NameTailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3575
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033445Metagenome / Metatranscriptome177N
F058173Metagenome / Metatranscriptome135N
F068794Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Draft_1008783710F068794GGTGGMKKEKGFIFNHQTITIRGSFINMLFTMVLMALFIVAAFRKEVADNLKMIAELIIAIYAISYGVWQGKKFLENKEKKKEEEPKE*
Draft_100878378F033445AGGAMVVELEKGRLCDKQVVHYEGAMKELSDQIGQLKVQVETMSVKFDETVKQLEAERKIADEKDKARIEEIKKAGSPQWTMLFGGFGAGAILVGVLILLL*
Draft_100878379F058173GGAGGMTYWIVAGVMIAVIALIAAYSYGRYHPSPDMVNQLTEQIRLETVKQYEQRINDLDKQLKISQTAYMESQKRYDNIITKLKEIKNAKNDIKPPQNMDELNTRFSNLGYTPIGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.