NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Lynggard_1016888

Scaffold Lynggard_1016888


Overview

Basic Information
Taxon OID3300000482 Open in IMG/M
Scaffold IDLynggard_1016888 Open in IMG/M
Source Dataset NameAnaerobic digester microbial communities from Northern Denmark, sample from Lynggard manure
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAalborg University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1579
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location NameSoeholt, Denmark
CoordinatesLat. (o)56.446744Long. (o)9.372697Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y
F004383Metagenome / Metatranscriptome440Y
F031138Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Lynggard_10168883F031138AGAAGGMMKRNNYVGPCAAACKPGAGTDTQNGTFDYIIVAAAEHAAREAGLPGRADRMIACRSCGAPTASSDGICRDCAEALREERADVLEGRCRIHRVRYVDDLPVSVLQEMQAEWGRC*
Lynggard_10168885F004383GGTGGMSDDNLLEQAFMARIRADEYREKLAKLREEFESSPEVMELNLSIERCEEERRQCIEQAKAAGISKQGSFRLKVRTRKTRTVIPERFFAKHGAEAFVECATIAIGKAEALLGKAALDDCCEVEVKEIGVSVEYERPEGSK*
Lynggard_10168886F003987GGAGGVIPALPCGTFSDSDTPVGAFFVAAFEDGDQPHHVGEYRIETLVRALRALQACGYDDVEIGSIFAPDPEHVHLLLIGLDGEARFGDRQLGC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.