NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold P_2C_Liq_1_UnCtyDRAFT_1000060

Scaffold P_2C_Liq_1_UnCtyDRAFT_1000060


Overview

Basic Information
Taxon OID3300000418 Open in IMG/M
Scaffold IDP_2C_Liq_1_UnCtyDRAFT_1000060 Open in IMG/M
Source Dataset NameMarine microbial community from Union City, CA, USA - Pond 2C Liquid 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)40711
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (25.64%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameEden Landing Ponds, San Francisco, CA, USA
CoordinatesLat. (o)37.569167Long. (o)-122.1019Alt. (m)Depth (m).13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024316Metagenome / Metatranscriptome206Y
F047638Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
P_2C_Liq_1_UnCtyDRAFT_100006032F024316N/AMKLTRILIGEILESNPGFEREIDKLKDKGATYIDSGDYGSVYLLNGKAVKVTTDEVELEHAEKLKGKKTNNFVYIYDVEVINPKLGIITMDIMGKFKGEIPEEFLHNLEKEAKSLGIDPEELDIRPDNFMVHPKSGNLKMTDV*
P_2C_Liq_1_UnCtyDRAFT_10000607F047638AGGMKILNIISEIQFAVYQGMVRIGHAESITVQDIGEMLRAMPGVLTVGQVSHNSDNNTAVMKVKLLTTKPPSEAFNSFKNTSIQRIPEVKRIEIAEKTIEKKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.