Basic Information | |
---|---|
Taxon OID | 3300000258 Open in IMG/M |
Scaffold ID | LP_J_09_P20_1000DRAFT_1028267 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_09_P20_1000 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 653 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Line P, North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 48.35 | Long. (o) | -123.3 | Alt. (m) | Depth (m) | 1000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016996 | Metagenome / Metatranscriptome | 243 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LP_J_09_P20_1000DRAFT_10282671 | F016996 | N/A | VVNDGSVYQPWKNDFEPEGEQELTEVHWSNKGEPPAPKGMHKLRSGRDIPSTPKVDKIHNKVAAMTDRNDHFGATIQLAKECGDKDLVQIYNALELMHXKYGVVGNKSIELRQIFSPVLNNQLDRKFGKYANVLRDAL* |
⦗Top⦘ |