NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LP_F_10_SI03_100DRAFT_1045239

Scaffold LP_F_10_SI03_100DRAFT_1045239


Overview

Basic Information
Taxon OID3300000257 Open in IMG/M
Scaffold IDLP_F_10_SI03_100DRAFT_1045239 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)678
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameLine P, North Pacific Ocean
CoordinatesLat. (o)48.35Long. (o)-123.3Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068714Metagenome124N

Sequences

Protein IDFamilyRBSSequence
LP_F_10_SI03_100DRAFT_10452391F068714N/AMEIIETNKHSIIYRENKIGENSGVVTVVPNTSYFRMKVLENKGERIKKDIPIEGVEILETFNGMIFNITLNGVTITTRPNMADAVVESFNDVEKIYKIFDEYNNNKYNMSLLTGILSKYGDRIKTFPAGFVIDDIFLIDRTGVAWFWDKEKQKVNTDSKKTNLGSGAICIVVNKTQNLTLKHNDKTIKIDRMGYII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.