


| Basic Information | |
|---|---|
| Taxon OID | 3300000243 Open in IMG/M |
| Scaffold ID | SA_S2_NOR18_50mDRAFT_1012366 Open in IMG/M |
| Source Dataset Name | Svalbard Archipelago station 2 sample NOR 18_50m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1709 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → Gramella forsetii → Gramella forsetii KT0803 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Adventfjord, Svalbard Archipelago | |||||||
| Coordinates | Lat. (o) | 78.243786 | Long. (o) | 15.656147 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096595 | Metagenome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SA_S2_NOR18_50mDRAFT_10123661 | F096595 | N/A | VKHIRSKKGLTQLQLSLKVFDKPNLEYIGKLERGTLAGITFTTADKIMLALESELEFREFESFQADYIA* |
| ⦗Top⦘ |