Basic Information | |
---|---|
Taxon OID | 3300000222 Open in IMG/M |
Scaffold ID | LPjun09P12500mDRAFT_1008390 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2388 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | P12, Pacific Ocean | |||||||
Coordinates | Lat. (o) | 48.97 | Long. (o) | -130.666667 | Alt. (m) | Depth (m) | 500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008561 | Metagenome / Metatranscriptome | 331 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LPjun09P12500mDRAFT_10083903 | F008561 | AGGA | MKFDELIEHYERAIGFNSTVKGVPMSEENLELCRRFVTDIHDCPRQDVRVMYRGPRTSYAHATLRKDALSFDVYCTPRYS* |
⦗Top⦘ |