| Basic Information | |
|---|---|
| Taxon OID | 3300000130 Open in IMG/M |
| Scaffold ID | SA_S2_NOR15_50mDRAFT_c10041572 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1965 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Adventfjord, Svalbard Archipelago | |||||||
| Coordinates | Lat. (o) | 78.243786 | Long. (o) | 15.656147 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023596 | Metagenome | 209 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SA_S2_NOR15_50mDRAFT_100415724 | F023596 | AGAAGG | MASKSLQALLLVCAGVIALLFVKLMFDMSRSMSEMTGYVGAISQDVSEMQNSMQTMNESMLRMEKSIHGLGQAFSQGSKQFQQMNPAGMMQQVLPDRDQRTR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |