Basic Information | |
---|---|
Taxon OID | 3300000124 Open in IMG/M |
Scaffold ID | BS_KBA_SWE12_21mDRAFT_c10003505 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5539 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | KBA site, Vaertahamnen, Baltic Sea, Sweden | |||||||
Coordinates | Lat. (o) | 59.363333 | Long. (o) | 18.119167 | Alt. (m) | Depth (m) | 21 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103514 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BS_KBA_SWE12_21mDRAFT_100035056 | F103514 | GAGG | MEKDISIKSITFNLKKNIKLIEIEVPGDEIIQSVEANSLDFEKLVKQKVIEYIQSL* |
⦗Top⦘ |