Scaffold BS_KBA_SWE12_21mDRAFT_c10000850

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BS_KBA_SWE12_21mDRAFT_c10000850

Scaffold BS_KBA_SWE12_21mDRAFT_c10000850

Overview

Basic Information
Taxon OID	3300000124 Open in IMG/M
Scaffold ID	BS_KBA_SWE12_21mDRAFT_c10000850 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	11252
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (23.53%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Peregrinibacteria → Candidatus Peribacteria → Candidatus Peribacterales → Candidatus Peribacteraceae → unclassified Candidatus Peribacteraceae → Candidatus Peribacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	KBA site, Vaertahamnen, Baltic Sea, Sweden
Coordinates	Lat. (^o)	59.363333	Long. (^o)	18.119167	Alt. (m)		Depth (m)	21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031100	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE12_21mDRAFT_100008509	F031100	N/A	MDDIPSILDTAKFRHLVLDGVSNIANSIQGFQIPEYDELELTYYGSTNNIATVVYKKASVVVATLNLTYSIQPPTSNDANLVLVSLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.