NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DelMOSum2010_c10000006

Scaffold DelMOSum2010_c10000006


Overview

Basic Information
Taxon OID3300000101 Open in IMG/M
Scaffold IDDelMOSum2010_c10000006 Open in IMG/M
Source Dataset NameMarine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)217426
Total Scaffold Genes251 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)207 (82.47%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location NameMicrobial Observatory off the coast of Delaware, USA
CoordinatesLat. (o)38.84917Long. (o)-75.1076Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002434Metagenome / Metatranscriptome559Y
F034140Metagenome / Metatranscriptome175Y
F049302Metagenome / Metatranscriptome147Y
F061869Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
DelMOSum2010_10000006113F061869GGAGGMANPYYFGQSPDESLGDSPRYFYALRRNEDGELYLLRSDQLKDKDSIDINLPGPPEETFEDLEPGVDFFDGINVNHVKDKENMYWTQYKWDQRSILYYVDGEGMLVQRINQNYAYPNGTSS*
DelMOSum2010_10000006138F002434GGAMATDSHDQMIEAFQKYFKWQERFEYHGSDEAGIKARFWLSEIRKHASQRRLEVQEKRSERKIARKGQVGRPKKVTTNDDVRMDLPEKED*
DelMOSum2010_10000006250F049302AGGAGMAKWRTGHGVDPVGTITETNIDTWWASKDRTIEHGWDDAHGHITKVISQGIPAGHSVKHGLNDAGNKYYLTISGDNINKTWS*
DelMOSum2010_100000066F034140AGGAMYRVYYTADTVEQYEGFYETQEEAEEVALHASEEYDAERVEVRDRFDNIIFVIDDEAVVIEEATGI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.