Basic Information | |
---|---|
Taxon OID | 3300000052 Open in IMG/M |
Scaffold ID | Draft_c018246 Open in IMG/M |
Source Dataset Name | Coal bed methane well microbial communities from Alberta, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1180 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alberta, Canada | |||||||
Coordinates | Lat. (o) | 52.119 | Long. (o) | -113.78 | Alt. (m) | Depth (m) | 686 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020006 | Metagenome / Metatranscriptome | 226 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_0182462 | F020006 | GAGG | MPKKRLSLAERYNLLEETKQRLRLEQEARTIARIEQLEIEACERLGRQLRLQHLELSGELECSDTDTARQYTLYLSDSEDDLTSEQNNSSTVETVNFVKSGSLLETPD* |
⦗Top⦘ |