


| Basic Information | |
|---|---|
| Taxon OID | 3300000051 Open in IMG/M |
| Scaffold ID | Botbay15_c014708 Open in IMG/M |
| Source Dataset Name | Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 15 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 895 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium TMED67 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Botany Bay, Sydney, Australia | |||||||
| Coordinates | Lat. (o) | -33.990833 | Long. (o) | 151.23195 | Alt. (m) | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005212 | Metagenome / Metatranscriptome | 408 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Botbay15_0147081 | F005212 | N/A | MNIYKTVFDTEQQGKDVLIQKDVWEEVTDEGVTSMRYINGTKAVVNIGKIVKV |
| ⦗Top⦘ |