Scaffold botbay04_c07829

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold botbay04_c07829

Scaffold botbay04_c07829

Overview

Basic Information
Taxon OID	3300000050 Open in IMG/M
Scaffold ID	botbay04_c07829 Open in IMG/M
Source Dataset Name	Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	946
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, Australia
Coordinates	Lat. (^o)	-33.990833	Long. (^o)	151.23195	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093411	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
botbay04_078293	F093411	GAGG	MSFLELSNEIAATIVQTLNIDERDAHYTDTVDMYAEWVSELMTITSEADSNMQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.