NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold botbay04_c02560

Scaffold botbay04_c02560


Overview

Basic Information
Taxon OID3300000050 Open in IMG/M
Scaffold IDbotbay04_c02560 Open in IMG/M
Source Dataset NamePorifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)750
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia

Source Dataset Sampling Location
Location NameBotany Bay, Sydney, Australia
CoordinatesLat. (o)-33.990833Long. (o)151.23195Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092950Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
botbay04_025602F092950GGAMFPGNKTIQCTLGMGLANVPWEWDYPMCPGNGTSQSALGMGLANVPCEWDYPMCLGNGTSQCAQGMGLFNVPWE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.