NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ARCol0oldRDRAFT_c00016

Scaffold ARCol0oldRDRAFT_c00016


Overview

Basic Information
Taxon OID3300000045 Open in IMG/M
Scaffold IDARCol0oldRDRAFT_c00016 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)12937
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (38.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUniversity of North Carolina, USA
CoordinatesLat. (o)35.9Long. (o)-79.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010126Metagenome / Metatranscriptome308Y
F068970Metagenome124N

Sequences

Protein IDFamilyRBSSequence
ARCol0oldRDRAFT_0001617F068970GAGMIINLNIPAFGKYFEDIKVYSDVYTGGGNSSKPINQFDPVNKEIYVGQTIKWSNPTAGAPYPHIVVFVSNQSAELESKISNITKPLHSSNGQSVVGNLNKLLIEDNNQNNKSNQTFSARSIVLPSVINTSSLAVKYLNANGSGIYSGAGYNFTGNERYVSSGLIWAGGVIPGNFAKINSFIVTFTKPGTYHYQCLIYPEMKGTIIVKPNLGLFEIFGNQVK*
ARCol0oldRDRAFT_000162F010126GGAMKSRNKSLIICTSVCMAALLQIITASQTVTAIDVPASSTNYNNYGFQLESNVTNSSSSEIVYKNPQHGISMLFPSNWTFSTSGLPQYTQVAAFYAPLQNLSDLIPARFTITVMSYQQNVSLKEFTXMTLSSLNETNQVKILSSNPTTLAGQXGYQVVFSTLPNMGSPVSFKIMHSWTAINNKIYVFEYGVESSKFNTYLPTVKQILDSLKIQAP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.