Basic Information | |
---|---|
Taxon OID | 3300000036 Open in IMG/M |
Scaffold ID | IMNBGM34_c048806 Open in IMG/M |
Source Dataset Name | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 555 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut → Passalidae Beetle Gut Microbial Communities From Costa Rica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Quebrada Gonzales Sector, Braulio Carrillo National Park, Costa Rica | |||||||
Coordinates | Lat. (o) | 10.207151 | Long. (o) | -84.007673 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001678 | Metagenome / Metatranscriptome | 653 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
IMNBGM34_0488061 | F001678 | AGGTGG | MRLFSIWVIEFLKLVGRQRLHPVATQCPICHQMVRLHVNKAGRRHVFGHARGLYEGSRFGEHYTAEMRCVGSGAPTAFNPRPNEDQRFKLPAVLLDD* |
⦗Top⦘ |