NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2222444295

Scaffold 2222444295


Overview

Basic Information
Taxon OID2222084003 Open in IMG/M
Scaffold ID2222444295 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAlabama State University
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)532
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.15Long. (o)-88.446Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039149Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
2222523886F039149AGGAGGMAINPNQIAVTKIYPGNYTNVLKYWHETKSVDFLNENGTTETLTNQPVGGPVGVVFRPGWIAQQAVGYVDLSYQALGSINQLEYYTQPFASGDSSNKPFTNGSVIIPSPDYHKDVRADITTGITVPSGAFVYR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.