NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GG70X8M02GXDWX

Scaffold GG70X8M02GXDWX


Overview

Basic Information
Taxon OID2189573024 Open in IMG/M
Scaffold IDGG70X8M02GXDWX Open in IMG/M
Source Dataset NameEcho Passage metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArizona Genomics Institute
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa

Source Dataset Sampling Location
Location NameKartchner Caverns, Benson, Arizona, USA
CoordinatesLat. (o)31.837801Long. (o)-110.350292Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009387Metagenome / Metatranscriptome318N

Sequences

Protein IDFamilyRBSSequence
KCEPM_01667720F009387N/AEEPVIYPAFVLAKFDTLRDEVLSRLGLHRGFPPRNEKRKRKEYAEALLRAFLPQTLSQIRGGKVAGVSMDQAAYFLSWVKTERPEGMEAVGAPKIIRTGFRPGGGGDPDFSYDEYVEFIEHFRDLAHKIPDEVLEAEKVQAAATLT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.