NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold G14TP7Y02FY16R

Scaffold G14TP7Y02FY16R


Overview

Basic Information
Taxon OID2170459017 Open in IMG/M
Scaffold IDG14TP7Y02FY16R Open in IMG/M
Source Dataset NameLitter degradation ZMR4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)681
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location NameUniversity of Illinois Energy Farm
CoordinatesLat. (o)40.1097Long. (o)-88.2041Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003085Metagenome / Metatranscriptome508Y

Sequences

Protein IDFamilyRBSSequence
4ZMR_01627290F003085N/ANGGPRISSRKRTQSRQSGATGRQQSCPREGERVGHHRGLRAGHGFRGVIRELGRASRLLGSNSRKEGDRLNQHPGVWWPMRPADEPTWPQAGRDTKQSASTQGTGRECKTNRPERTKAVVATHNTAGPGASLDRTRGEPRPKGPTITLRGAREGNAGHDVCAKERQEGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.