


| Basic Information | |
|---|---|
| Taxon OID | 2170459016 Open in IMG/M |
| Scaffold ID | G1P06HT01EJ3XB Open in IMG/M |
| Source Dataset Name | Litter degradation ZMR2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Illinois Energy Farm | |||||||
| Coordinates | Lat. (o) | 40.1097 | Long. (o) | -88.2041 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058472 | Metagenome / Metatranscriptome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2ZMR_04568380 | F058472 | GAGG | MPMPTVALDVPSARVLADQASIIAELQFVMDCCKRLLPELAKPEEERDQLMPLALWSSAVLAYGRCFSKGRRFALATEDVKELPLQ |
| ⦗Top⦘ |