| Basic Information | |
|---|---|
| Taxon OID | 2170459011 Open in IMG/M |
| Scaffold ID | GKWS7RC01B4JQT Open in IMG/M |
| Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Crateriforma → Crateriforma conspicua | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rothamsted, Harpenden, UK | |||||||
| Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021596 | Metagenome / Metatranscriptome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| F64_06274760 | F021596 | N/A | EVREFAGHSDIRTTELYFNRKEEDGEVAARRIQIRLTGRKTE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |