NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JCVI_READ_1243804

Scaffold JCVI_READ_1243804


Overview

Basic Information
Taxon OID2166559018 Open in IMG/M
Scaffold IDJCVI_READ_1243804 Open in IMG/M
Source Dataset NameMarine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)993
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004325Metagenome / Metatranscriptome443Y

Sequences

Protein IDFamilyRBSSequence
Ocean6-_02160860F004325N/AMKKKKSTTEKADQFLSGLGTAGGAIGSPQLMGFGGTDIQNQVMSGNIDEYASIRMRQGDTRIEEAAAMPSDLDASYLKLNLPGSPLPTNGLLAPQNIIGAQQTQDMIMSQEQMFLAQYLPAAGLSQLPVGQPPLESEKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.