NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold cont_contig14286

Scaffold cont_contig14286


Overview

Basic Information
Taxon OID2166559005 Open in IMG/M
Scaffold IDcont_contig14286 Open in IMG/M
Source Dataset NameSimulated microbial communities from Lyon, France
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1418
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France

Source Dataset Sampling Location
Location NameLyon, France
CoordinatesLat. (o)45.7580538Long. (o)4.7649095Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008268Metagenome / Metatranscriptome336Y

Sequences

Protein IDFamilyRBSSequence
cont_0286.00001640F008268N/AVTAAEIVREIERLPSEEKAEVLSALLHSQRNGSKLSPDELLALADQMIAAKDPEEADRLEAKILAGFYGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.