Basic Information | |
---|---|
Taxon OID | 2162886008 Open in IMG/M |
Scaffold ID | PRSSGFe2_Sequence0000001033 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Puerto Rico rain forest, that decompose switchgrass - Feedstock-adapted consortia SG + Fe |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12852 |
Total Scaffold Genes | 20 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (55.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Soil → Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Luquillo LTER tropical forest, Puerto Rico | |||||||
Coordinates | Lat. (o) | 18.3724 | Long. (o) | -65.7166 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088999 | Metagenome / Metatranscriptome | 109 | Y |
F096286 | Metagenome | 105 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PRSSGFe2_0033.00001310 | F096286 | AGGTGG | VNRRRVKTVRLKHEHSALIDPSMKGKKVDHIRFSQAERSIVYVSVVFDDRTEWSIAIESFSLPTARVSHFVTIEEDPIAETGLMFLPDDSSSYPQFDQIQQPPKQRKPSKKSKK |
PRSSGFe2_0033.00001350 | F088999 | GAGG | MNNKLLLMLCAFLAVAVSATAQETSDKFAIFVTGVGDATPVAQSLVKKLNASKPFEVVSKNDIAKVVVLVSCSSRKQTDPFLCMYVAHFNGPAFKTFLGGGMWAATNADAVSDNFLASIAQDIVERFDSTSKENLREALQACLLMTDSKCNVPDPLQKEFDAKQLTLGQYLLKKNQ |
⦗Top⦘ |