Basic Information | |
---|---|
Taxon OID | 2124908045 Open in IMG/M |
Scaffold ID | KansclcFeb2_ConsensusfromContig154874 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 605 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.1049 | Long. (o) | -96.6054 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087912 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KansclcFeb2_14626270 | F087912 | AGGAGG | MIRPEFKNTLLDQRGAAIILWSFFAISIPIYLVIARQLLGNPKLGTNPAIAEPSRLVFWILTLVDLGYYVYWRRKNLTTEGIRRDARQSKLFRALEEFNGVDEQNAAYFVSTYVTRKVVLFAIIEAIGVYGFV |
⦗Top⦘ |