Basic Information | |
---|---|
Taxon OID | 2124908031 Open in IMG/M |
Scaffold ID | OB25_ConsensusfromContig2362 Open in IMG/M |
Source Dataset Name | Obsidian Pool |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | HudsonAlpha Institute for Biotechnology, Oak Ridge National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 527 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Nanoarchaeal Communities From Obsidian Pool, Yellowstone National Park |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Obsidian Pool, Yellowstone National Park, USA | |||||||
Coordinates | Lat. (o) | 44.6 | Long. (o) | -110.433 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021808 | Metagenome / Metatranscriptome | 217 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OB25_00063590 | F021808 | N/A | MNEEPPYGTTAWFFYEIDEKQRQIYELVFDIEEKIAKIKDLLNEIDLLKAQLETNINVGK |
⦗Top⦘ |