NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OB25_ConsensusfromContig2362

Scaffold OB25_ConsensusfromContig2362


Overview

Basic Information
Taxon OID2124908031 Open in IMG/M
Scaffold IDOB25_ConsensusfromContig2362 Open in IMG/M
Source Dataset NameObsidian Pool
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHudsonAlpha Institute for Biotechnology, Oak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)527
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Nanoarchaeal Communities From Obsidian Pool, Yellowstone National Park

Source Dataset Sampling Location
Location NameObsidian Pool, Yellowstone National Park, USA
CoordinatesLat. (o)44.6Long. (o)-110.433Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021808Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
OB25_00063590F021808N/AMNEEPPYGTTAWFFYEIDEKQRQIYELVFDIEEKIAKIKDLLNEIDLLKAQLETNINVGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.