NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OU_2_1_1_newblercontig28541

Scaffold OU_2_1_1_newblercontig28541


Overview

Basic Information
Taxon OID2124908016 Open in IMG/M
Scaffold IDOU_2_1_1_newblercontig28541 Open in IMG/M
Source Dataset NameSample 642
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)642
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046523Metagenome151N

Sequences

Protein IDFamilyRBSSequence
OU_01073850F046523GAGMAHLRSRLLSWPVLLAVLAVAVLLVVLVQRSSGESLTPTDQAFAKVCRDHGGTPTFAPGSEDYVKDARGCTIEYGGDAYEMYAVHPEGFSAREAAQARHACTLLARQKRAESARGDDVGSVRVVWHPRSAICESQP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.