Basic Information | |
---|---|
Taxon OID | 2124908016 Open in IMG/M |
Scaffold ID | OU_2_1_1_newblercontig17957 Open in IMG/M |
Source Dataset Name | Sample 642 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Los Alamos National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 794 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002173 | Metagenome / Metatranscriptome | 587 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OU_01287770 | F002173 | N/A | PKLAHAYVDAWSSTKSAKWLEDNYGYGHANTRARPSSTDLLKALQITNPKAVTEPNAHLDRDIPRRALYAKKWEEVKAA |
⦗Top⦘ |