NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPKC_F5V46DG02ET4PZ

Scaffold GPKC_F5V46DG02ET4PZ


Overview

Basic Information
Taxon OID2067725004 Open in IMG/M
Scaffold IDGPKC_F5V46DG02ET4PZ Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Kansas Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)551
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameKansas, USA
CoordinatesLat. (o)39.211666Long. (o)-96.594768Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003245Metagenome / Metatranscriptome498Y

Sequences

Protein IDFamilyRBSSequence
GPKC_07132580F003245GGAMPRSAGRFRWGSRVRPRSSSGPVIQSGPSGQTFTSFGYLIRVSGASRSGLFHGTQTSEKTALLTAYATGELHARTVDQAVHSLDIVGTMTVYQRKTPGASFGHPASFRAGTPVARYHMTLQDILTVFAPDTGLPTLTGDMVQTAAHALSGPLAGRTFGRRGTRLRFFATGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.