NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GB_4MN_MetaGALL_nosff_c3224

Scaffold GB_4MN_MetaGALL_nosff_c3224


Overview

Basic Information
Taxon OID2061766003 Open in IMG/M
Scaffold IDGB_4MN_MetaGALL_nosff_c3224 Open in IMG/M
Source Dataset NameHydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2887
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California

Source Dataset Sampling Location
Location NameGulf of California
CoordinatesLat. (o)27.506Long. (o)-111.347Alt. (m)Depth (m)1996
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007055Metagenome / Metatranscriptome359Y
F010477Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
GB_4MN_01698220F007055GAGMTVIWIAIVMTWNPVIYTIDKEFSSEVNCWNYYDNGAGESEMRSRYGTQVLDHQDNKPDKDYMKKHRPAHREYPTRIYKNHGGWMVCVTCDLPDCVSQL
GB_4MN_01698250F010477N/AMKIYVQIRYLVFIPYLIFIGMMGGNILAESIVVGLALAIYDFFFDNDG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.