Basic Information | |
---|---|
Taxon OID | 2061766003 Open in IMG/M |
Scaffold ID | GB_4MN_MetaGALL_nosff_c15963 Open in IMG/M |
Source Dataset Name | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 536 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of California | |||||||
Coordinates | Lat. (o) | 27.506 | Long. (o) | -111.347 | Alt. (m) | Depth (m) | 1996 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019388 | Metagenome / Metatranscriptome | 230 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GB_4MN_00483890 | F019388 | N/A | ISLKGTVMRTEQNPYLVETKKGQILKFSRIDADNEAVSKQLDGDDVEVYHDGKLQYKLHGIEQGKLF |
⦗Top⦘ |