Basic Information | |
---|---|
Taxon OID | 2061766000 Open in IMG/M |
Scaffold ID | BDMC2_FXAG6RB01BEXFX Open in IMG/M |
Source Dataset Name | Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor → Benzene-Degrading Bioreactor Microbial Communities From Toronto, Ontario, Canada, That Are Methanogenic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Toronto, Ontario | |||||||
Coordinates | Lat. (o) | 43.658712 | Long. (o) | -79.396003 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098292 | Metagenome / Metatranscriptome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BDMC2_01392260 | F098292 | GGAG | MSDVTRRIERWQKKYSPERAKATLDQLHEGMQQRYEAATREMVAMELQVKEVLNQEGVHTTNYVPYLSYARQLWKLGRQQNISGESFAMASEVLLQKWAGRGQNPDVLAAIRTKVFNSPPPKP |
⦗Top⦘ |