


| Basic Information | |
|---|---|
| Taxon OID | 2046860006 Open in IMG/M |
| Scaffold ID | LWAeNiSIP_F6BA1ZZ02I5FF6 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C methane aerobic+nitrate |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Washington, Seattle, Washington, USA | |||||||
| Coordinates | Lat. (o) | 47.07 | Long. (o) | -122.27889 | Alt. (m) | Depth (m) | 62 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021563 | Metagenome / Metatranscriptome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LWAeNiSIP_4792730 | F021563 | N/A | QCINLIEDLKMLLIDRLKSKGMDPVLIPAFLKALTSLISSEPGIEPARATQKMRSLGWDEVSVDYHCLQIVIACLEADTKAKKDPIN |
| ⦗Top⦘ |