Basic Information | |
---|---|
Taxon OID | 2035918004 Open in IMG/M |
Scaffold ID | FACENC_F56XM5W01DEZKS Open in IMG/M |
Source Dataset Name | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 521 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Orange County, North Carolina | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -80.934 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090195 | Metagenome / Metatranscriptome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FACENCA_5152510 | F090195 | N/A | AIVGVIRYHFRERLEGVKPGGKQYSAPAYETEQLPPSSASSNKEQVQVIKGKVAHLPYSFVINLGGKGAGTLEVNILTSDGEPLRGYPKTVANAFGQATEATSQDFEIPVTPELAAKIEKDLLQKNQHLTQVQLVVQPSQ |
⦗Top⦘ |