NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FACENC_F56XM5W01BD3YB

Scaffold FACENC_F56XM5W01BD3YB


Overview

Basic Information
Taxon OID2035918004 Open in IMG/M
Scaffold IDFACENC_F56XM5W01BD3YB Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site 2 North Carolina CO2-
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameOrange County, North Carolina
CoordinatesLat. (o)36.0Long. (o)-80.934Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001842Metagenome / Metatranscriptome627Y

Sequences

Protein IDFamilyRBSSequence
FACENCA_4953490F001842N/AETFFYRDINDAEHNATIHSGKDLKSKSRWDHDVLKVTTTQSGAVTLESYSLAPDGNMLVNVVRPEHKPVTLVFQRK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.