| Basic Information | |
|---|---|
| Taxon OID | 2029527002 Open in IMG/M |
| Scaffold ID | NTS_CREO_AM_FWG71BA01CEL13 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nevada Desert Research Center | |||||||
| Coordinates | Lat. (o) | 36.766667 | Long. (o) | -115.95 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104556 | Metagenome / Metatranscriptome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NTS_CREO_AMB_1322800 | F104556 | N/A | LATLVSSTSAVGGCPILFASPAERSNVSAYDEAEGDALRLLRAIDAEQTHGRVGASVFAFAAARSAGLRPGTERYEEALWRLVCEEALTVDEHIPPEVAAKVPFGRAPYRLAPAAVRMLAKA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |