| Basic Information | |
|---|---|
| Taxon OID | 2022920004 Open in IMG/M |
| Scaffold ID | YNPsite06_CeleraDRAF_deg1119010597231 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP6 White Creek Site 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 739 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.733519 | Long. (o) | -110.404033 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080677 | Metagenome / Metatranscriptome | 115 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YNPsite06_CeleraDRAFT_84620 | F080677 | N/A | IFLMKKEFLQELLENVAWWSLGWFALLSGLLNLTQGFWGWLSAICFLLASMVTLPIFWSWLTSKIIVLQSPKLVRKITIGAMFLLLLAVMLTPVSVDQQTTFASEVRSDSTTELPIVKQPTETVPLIIKLISSLGG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |