NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold QLn_FQAYR3Y01CVFL0

Scaffold QLn_FQAYR3Y01CVFL0


Overview

Basic Information
Taxon OID2022920000 Open in IMG/M
Scaffold IDQLn_FQAYR3Y01CVFL0 Open in IMG/M
Source Dataset NameSaline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location
Location NameQinghai Lake, Tibetan Plateau
CoordinatesLat. (o)36.381Long. (o)100.218Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058820Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
QL_na_8842430F058820AGGAGGMDELNQLEYSEWLHWCGYTDAELYSWPLDNDPSYMAGFALGYAEIQQRRKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.