Basic Information | |
---|---|
Taxon OID | 2022920000 Open in IMG/M |
Scaffold ID | QLn_FQAYR3Y01CFH3N Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 540 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Qinghai Lake, Tibetan Plateau | |||||||
Coordinates | Lat. (o) | 36.381 | Long. (o) | 100.218 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058806 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
QL_na_14756010 | F058806 | N/A | MVGLFYIHLPMSFSIPQQIEKDIIAGRAQYRTFQTGNGGQSILQVPTNSYAVIYGYDFSPAGGGLKFSSTIQSAAATLNRAVLNASVIRFFETQQISFYTGTDFYPFIHHIDVKTTAST |
⦗Top⦘ |