| Basic Information | |
|---|---|
| Taxon OID | 2014613002 Open in IMG/M |
| Scaffold ID | 2014619776 Open in IMG/M |
| Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 1_Upper_euphotic_10m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 964 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station | |||||||
| Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068722 | Metagenome / Metatranscriptome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2014627470 | F068722 | AGGAG | MKIEFDYKQGEWIQLKSYLFPYLKKSELVQDFVKKVNTKTKLRTIK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |