NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106132

Metagenome / Metatranscriptome Family F106132

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106132
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 176 residues
Representative Sequence GCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 24.24 %
% of genes near scaffold ends (potentially truncated) 76.00 %
% of genes from short scaffolds (< 2000 bps) 81.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(15.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.04%    β-sheet: 29.15%    Coil/Unstructured: 63.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01266DAO 18.00
PF04909Amidohydro_2 4.00
PF06245DUF1015 2.00
PF08352oligo_HPY 2.00
PF13487HD_5 1.00
PF00496SBP_bac_5 1.00
PF01035DNA_binding_1 1.00
PF02668TauD 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 2.00
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 1.00
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 1.00
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101645780All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1687Open in IMG/M
3300000550|F24TB_10021106All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1333Open in IMG/M
3300000559|F14TC_103891076All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1403Open in IMG/M
3300001431|F14TB_100115729All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1665Open in IMG/M
3300001431|F14TB_100256882All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium558Open in IMG/M
3300003993|Ga0055468_10031457All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300003997|Ga0055466_10121148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium728Open in IMG/M
3300004114|Ga0062593_100049296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2609Open in IMG/M
3300004157|Ga0062590_100042094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2448Open in IMG/M
3300004463|Ga0063356_100258032All Organisms → cellular organisms → Bacteria2120Open in IMG/M
3300004643|Ga0062591_101563856All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium662Open in IMG/M
3300005093|Ga0062594_101300999All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium729Open in IMG/M
3300005332|Ga0066388_101830565All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1081Open in IMG/M
3300005332|Ga0066388_104219464All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300005334|Ga0068869_101936204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium528Open in IMG/M
3300005353|Ga0070669_101910325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium518Open in IMG/M
3300005457|Ga0070662_101441435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria593Open in IMG/M
3300005457|Ga0070662_101956689All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300005459|Ga0068867_100382096All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1183Open in IMG/M
3300005459|Ga0068867_100543414All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1005Open in IMG/M
3300005459|Ga0068867_100963437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium771Open in IMG/M
3300005545|Ga0070695_100383402All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1061Open in IMG/M
3300005844|Ga0068862_100261382All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1580Open in IMG/M
3300006796|Ga0066665_11317526All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300006844|Ga0075428_100013504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00179091Open in IMG/M
3300006845|Ga0075421_100269964All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300006845|Ga0075421_101902916All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium637Open in IMG/M
3300006846|Ga0075430_100415694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1110Open in IMG/M
3300006846|Ga0075430_100798181All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300006847|Ga0075431_100333709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1527Open in IMG/M
3300006853|Ga0075420_100193195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1779Open in IMG/M
3300006954|Ga0079219_11110285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfocurvus → Desulfocurvus vexinensis672Open in IMG/M
3300006969|Ga0075419_10033533All Organisms → cellular organisms → Bacteria3191Open in IMG/M
3300009012|Ga0066710_101125973All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1214Open in IMG/M
3300009038|Ga0099829_11233227All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium619Open in IMG/M
3300009089|Ga0099828_10073529All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300009090|Ga0099827_10281049All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300009100|Ga0075418_11767454All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium672Open in IMG/M
3300009147|Ga0114129_10546829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1506Open in IMG/M
3300009147|Ga0114129_11783289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium749Open in IMG/M
3300009156|Ga0111538_12198786All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium693Open in IMG/M
3300009157|Ga0105092_10035281All Organisms → cellular organisms → Bacteria2661Open in IMG/M
3300009553|Ga0105249_12451415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → Desulfovibrio aminophilus594Open in IMG/M
3300010043|Ga0126380_10836710All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium757Open in IMG/M
3300010371|Ga0134125_10730466All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1091Open in IMG/M
3300010400|Ga0134122_10007273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00178230Open in IMG/M
3300012096|Ga0137389_10468267All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1080Open in IMG/M
3300012189|Ga0137388_10154118All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300012929|Ga0137404_10124340All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300012930|Ga0137407_10097838All Organisms → cellular organisms → Bacteria2508Open in IMG/M
3300013308|Ga0157375_10211979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2095Open in IMG/M
3300014267|Ga0075313_1147129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter → Helicobacter apodemus604Open in IMG/M
3300014272|Ga0075327_1041319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1367Open in IMG/M
3300014302|Ga0075310_1118010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfocurvus → Desulfocurvus vexinensis578Open in IMG/M
3300015371|Ga0132258_12891337All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1194Open in IMG/M
3300017792|Ga0163161_11001796All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium713Open in IMG/M
3300018422|Ga0190265_11676152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales746Open in IMG/M
3300019259|Ga0184646_1480902All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1077Open in IMG/M
3300019377|Ga0190264_11613664All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium571Open in IMG/M
3300020004|Ga0193755_1002919All Organisms → cellular organisms → Bacteria → Proteobacteria5410Open in IMG/M
3300021081|Ga0210379_10045565All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300025911|Ga0207654_10209023All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1289Open in IMG/M
3300025933|Ga0207706_11457348All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300025972|Ga0207668_10479695All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1066Open in IMG/M
3300027722|Ga0209819_10139941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium847Open in IMG/M
3300027907|Ga0207428_10146117All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1802Open in IMG/M
3300027909|Ga0209382_10145254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2752Open in IMG/M
3300028380|Ga0268265_10431649All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1226Open in IMG/M
3300028587|Ga0247828_10111560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1312Open in IMG/M
3300028592|Ga0247822_11895818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfocurvus → Desulfocurvus vexinensis510Open in IMG/M
3300028596|Ga0247821_10867303All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium599Open in IMG/M
3300028608|Ga0247819_11023906All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium523Open in IMG/M
3300028807|Ga0307305_10444041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfocurvus → Desulfocurvus vexinensis584Open in IMG/M
3300028809|Ga0247824_10370555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium821Open in IMG/M
3300028809|Ga0247824_10533952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium696Open in IMG/M
3300028812|Ga0247825_10003534All Organisms → cellular organisms → Bacteria10320Open in IMG/M
3300028814|Ga0307302_10703407All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300028819|Ga0307296_10668587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter → Helicobacter apodemus568Open in IMG/M
3300028889|Ga0247827_10109806All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1399Open in IMG/M
3300030006|Ga0299907_10079632All Organisms → cellular organisms → Bacteria2662Open in IMG/M
3300030006|Ga0299907_10635336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium826Open in IMG/M
3300030336|Ga0247826_10101615All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300030619|Ga0268386_10064080All Organisms → cellular organisms → Bacteria → Proteobacteria2881Open in IMG/M
3300030619|Ga0268386_10408515All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium953Open in IMG/M
3300031198|Ga0307500_10304686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter → Helicobacter apodemus507Open in IMG/M
3300031720|Ga0307469_11016834All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium775Open in IMG/M
3300031740|Ga0307468_100085708All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1815Open in IMG/M
3300031740|Ga0307468_100125784All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1589Open in IMG/M
3300031740|Ga0307468_101457281All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300031847|Ga0310907_10665108All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300031852|Ga0307410_10991374All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium724Open in IMG/M
3300031858|Ga0310892_11400280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter → Helicobacter apodemus502Open in IMG/M
3300031908|Ga0310900_10106913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1809Open in IMG/M
3300031943|Ga0310885_10111735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1257Open in IMG/M
3300032075|Ga0310890_11085824All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium647Open in IMG/M
3300032174|Ga0307470_10499966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium887Open in IMG/M
3300032828|Ga0335080_10306781All Organisms → cellular organisms → Bacteria → Proteobacteria1722Open in IMG/M
3300033551|Ga0247830_11356176All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300033815|Ga0364946_168981All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil15.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10164578033300000364SoilCEDGKPRCCDGKVSASCRXGSEKFTTRQISVDTQPLISVADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVALQRNRSTIFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
F24TB_1002110623300000550SoilMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTPAAAAGSAGCCHYNKGVCSCKDGTPTCCDGKVSASCSCPSITTRQITIDTQPLISVADFAFASQETPEPPSPRLALFRLGSADALRFWFRLDCNDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQSIMLPRNRSTVFVARPAGQLRQGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
F14TC_10389107623300000559SoilCHYNKGVCGCDSGRARCCDGKVSASCRCNAGLTTRQIRIEAEPLVSVADFAFASQAIPEPPSPRLTLFRLGPDTLRFWFRLNCGPECWSQLAVNNALALEVRWLFDPGSGPTLEGDPQPITLQQDRPSAFITRRPNELRQGRWETEVRFDTERLCTRPDGKCWFRIEVRR*
F14TB_10011572923300001431SoilQATTGCCHYNKGVCGCDSGRARCCDGKVSASCRCNAGLTTRQIRIEAEPLVSVADFAFASQAIPEPPSPRLTLFRLGPDTLRFWFRLNCGPECWSQLAVNNALALEVRWLFDPGSGPTLEGDPQPITLQQDRPSAFITRRPNELRQGRWETEVRFDTERLCTRPDGKCWFRIEVRR*
F14TB_10025688213300001431SoilCCDGKVSASCSCPSITTRQITIDTQPLISVADFAFASQETPEPPSPRLALFRLGSADALRFWFRLDCNDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQSIMLPRNRSTVFVARPAGQLRQGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0055468_1003145723300003993Natural And Restored WetlandsMRRRLTTLVLATLALGVIAWLAGPLAGSGGSCLVPAASAAGRAGCCHYNRGVCGCQNGRARCCDGKVSASCRCNAGLTTRQIGINTEPLVSLADVAFARQDMPEPPSPRLTLFRLGADPLRFWFKLDCGPECWNQLAVDNVLPLEVRWLFDPGSGPVVDGDPQRVTLLRDRPTVFVARPPSQLRQGRWETEVRFETERLCTRGDEKCWFQIEVQR*
Ga0055466_1012114813300003997Natural And Restored WetlandsGCCHYNRGVCGCQNGRARCCDGKVSASCRCNAGLTTRQIGINTEPLVSLADVAFARQDMPEPPSPRLTLFRLGADPLRFWFKLDCGPECWNQLAVDNALPLEVRWLFDPGSGPVVDGDPQRVTLLRDRPTVFVARPPSQLRQGRWETEVRLDTERLCTRGDEKCWFQIEVQR*
Ga0062593_10004929643300004114SoilPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR*
Ga0062590_10004209413300004157SoilCDGKVSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0063356_10025803223300004463Arabidopsis Thaliana RhizosphereMRRRLTTLGLVTLALGVTAWFAGAVAGTDGGCLVPAASAAGSTGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR*
Ga0062591_10156385623300004643SoilSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0062594_10130099923300005093SoilRCNSGLTTRQISYDTQPLVRLADFAFAGQDLPEPPSPRLTLFRLGTDALRFWFRLDCGEECWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLTAFVPRPPAQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRR*
Ga0066388_10183056523300005332Tropical Forest SoilMSLTTRALMVVATLGLGIVTWSGGPLPGSPGSCGIAPAAAAGSSGCCHYNKGVCGCEDGKPRCCDGKLSASCRCGSGNVTTRQISVDTEPLISVADFAFASKETEPPSPRLTLFRLGSEPLRFWFRVECGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQAIKLARDRSTVFAARPVNQLRQGRWETEVRFDTERLCTRGDEKCWFRIQVQK*
Ga0066388_10421946413300005332Tropical Forest SoilGKPRCCDGKLSASCRCGSGNVTTRQISVDTQPLISVADFAFASQETEPPNPRLTLFRLGRDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGEPQAVKLARDRSTVFVARPATQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0068869_10193620413300005334Miscanthus RhizosphereCDGKVSASCRCNSGLTTRQISYDTQPLIRLADFAFAGQDLPEPPSPRLTLFRLGADALRFWFRLDCGEDCWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLTAFVPRPPAQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRR*
Ga0070669_10191032523300005353Switchgrass RhizosphereTRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR*
Ga0070662_10144143513300005457Corn RhizosphereYNKGVCGCEGGRARCCDGKVSASCRCNSGLTTRQISYDTQPLIRLADFAFAGQELPEPPSPRLTLFRLGADALRFWFRLDCSEDCWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLAAFVPRPPTQLRQGRWETEVRFDTERLCTRADGKCWFRIEVRR*
Ga0070662_10195668923300005457Corn RhizosphereAGLTTRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR*
Ga0068867_10038209623300005459Miscanthus RhizosphereCCHYNKGVCGCEDGKPRCCDGKVSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLASEPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0068867_10054341413300005459Miscanthus RhizosphereSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0068867_10096343713300005459Miscanthus RhizosphereRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRCETEVRFDTVRLCTRADGRCWFRIEVRR*
Ga0070695_10038340223300005545Corn, Switchgrass And Miscanthus RhizosphereAAAAGTAGCCHYNKGVCGCEGGRARCCDGKVSASCRCNAGLTTRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR*
Ga0068862_10026138223300005844Switchgrass RhizosphereGKPRCCDGKVSASCRCGSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0066665_1131752613300006796SoilSCACTDKPLTRQITVDAQSPLGLADFAFAGHESPEPPSPRLALFRLGADALRFWFKVDCGDDCWGRLAVNGHLPLEVRWLFDPGSGPMLDGSPQAVVLQRNRPSVFVARPVTNLRQGRWETEVRFDTERLCTRDDDRCWFRVEVRR*
Ga0075428_10001350483300006844Populus RhizosphereMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCSGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0075421_10026996433300006845Populus RhizosphereGLVTLALGVTAWFAGAVAGTDGGCLVPAASAAGSTGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR*
Ga0075421_10190291613300006845Populus RhizosphereSASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPADGKCWFRIEVRR*
Ga0075430_10041569413300006846Populus RhizosphereGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0075430_10079818123300006846Populus RhizosphereMRRRLTTLGLVTLALGVTAWFAGAVAGTDGGCLVPAASAAGSTGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQ
Ga0075431_10033370913300006847Populus RhizosphereAEPLVSVADFAFASQATPEPPSPRLTLFRLGPDTLRFWFRLNCGPECWSQLAVNNALALEVRWLFDPGSGPALEGDPQPITLQQDRPSAFITRRPNELRQGRWETEVRFDTERLCTRPDGKCWFRIEVRR*
Ga0075420_10019319523300006853Populus RhizosphereMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0079219_1111028513300006954Agricultural SoilMTRRRLIILGIAALVLAPGTWLALGRDGGCVVPAAAAAGTTGCCHYNQGVCGCENGRARCCDGKASASCRCNSGITTRQLGVDTDPLVSLADVAFAGSDMPEPPSQRLTIFKLAADPLRFWFRVNCGADCWSQLGSNDTLPLQVRWLFDPGSGPVLEGDPQPITVSRARPAIFVPRPPNQLRQGRWETEVRFDTERLCTRGDDKCWFRIEVRK*
Ga0075419_1003353333300006969Populus RhizosphereMRRLTATVLATLAVGVVAWLAAPAVGLDGRCLVPAASAQAPTGCCHYNKGVCGCESGRARCCDGKVSASCRCAAGLTTRQIRIDAEPLVSVADFAFAGQATPEPPSPRLTLFRLGPDPLQFWFRLNCGPECWSQLAVNGALALEVRWLFDPGSGPALEGEPQTVSLQRDRSSVFVSRRPNELRQGRWETEVRFDTERLCTRPDGKCWFRVEVRR*
Ga0066710_10112597323300009012Grasslands SoilNCEGGRARCCDGKVSASCACTDKPLTRQITVDAQSPLGLADFAFAGHESPEPPSPRLALFRLGADALRFWFKVDCGDDCWGRLAVNGHLPLEVRWLFDPGSGPMLDGSPQAVALQRNRPSVFVARPVTNLRQGRWETEVRFDTERLCTRDDDRCWFRVEVRR
Ga0099829_1123322723300009038Vadose Zone SoilGVCNCEGGRARCCDGKVSASCACTDKPLTREITVDAQSPLGLADFAFASQEFPEPPSPRLSWFRLGADALRFWFKLDCGDDCWARLAVNGQLPLEVHWLFDPGSGPMLDGNPQTVVLQRNRHSVFVARPVSQLRHGRWETEVRFDTERLCTRGDDRCWFRVEVRR*
Ga0099828_1007352933300009089Vadose Zone SoilMATLVSPAIRAMLVLVTLGLGVGGWISPSRPGDAGRCGVVPAAAASSGGCCHYNMGVCNCEGGRARCCDGKVSASCACTDKPLTREITVDAQSPLGLADFAFASQEFPEPPSPRLSWFRLGADALRFWFKLDCGDDCWARLAVNGQLPLEVRWLFDPGSGPMLDGSPQTVVLHRNRHSVFVARPVSQLRHGRWETEVRFDTERLCTRGDDRCWFRVEVRR*
Ga0099827_1028104923300009090Vadose Zone SoilMATLVSPAIRAMLVLVTLGLGVGGWTGPSRPGDAGRCGVVPAAAASSGGCCHYNMGVCNCEGGRARCCDGKVSASCACTDKPLTREITVDAQSPLGLADFAFASQEFPEPPSPRLSWFRLGADALRFWFKLDCGDDCWARLAVNGQLPLEVRWLFDPGSGPMLDGSPQTVVLQRNRYSVFVARPVSQLRHGRWETEVRFDTERLCTRGDDRCWFRVEVRR*
Ga0075418_1176745423300009100Populus RhizosphereGCEQGRARCCDGKISASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLLKLGKDALRFWFRLDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALPRERLTAYVTRTANQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRR*
Ga0114129_1054682923300009147Populus RhizosphereMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTSRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0114129_1178328913300009147Populus RhizosphereGGLQPGGDGGCAVPTAAAAGTAGCCHYNKGVCGCEQGRARCCDGKISASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPADGKCWFRIEVRR*
Ga0111538_1219878623300009156Populus RhizosphereAASAQAPTGCCHYNKGVCGCESGRARCCDGKVSASCRCAAGLTTRQIRIDAEPLVSVADFAFAGQATPEPPSPRLTLFRLGPDPLQFWFRLNCGPECWSQLAVNGALALEVRWLFDPGSGPALEGEPQTVSLQRDRSSVFVSRRPNELRQGRWETEVRFDTERLCTRPDGKCWFRVEVRR
Ga0105092_1003528113300009157Freshwater SedimentTASAAGPAGCCHYNKGVCGCESGRARCCDGKVSASCRCGGSGVTTRQIRIDTEPLVSLADFAFANQETSEPPSPRLTLFRLGPDPLRFWFKLSCGEECWRQLAVDGALPLEVRWLFDPGGGPVLEGAPQRVTLQRDHPAVFVARPPTQLRQGRWETEVRLDTERLCTRGDARCWFRIEVRR*
Ga0105249_1245141513300009553Switchgrass RhizosphereASAAAGGGGCCHYNKGVCGCEGGRARCCDGKVSASCRCNSGLTTRQISYDTQPLIRLADFAFAGQELPEPPSPRLTLFRLGADALRFWFRLDCGEDCWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLAAFVPRPPTQLRQGRWETEVRFDTERLCTRADGKCWFRIEVRR
Ga0126380_1083671023300010043Tropical Forest SoilRIEAEPLVSVADFAFASQATPEPPSPRLTLFRLGPDMLRFWFRLNCGPECWSQLAVNNALALEVRWLFDPGSGPTLEGDPQPITLQQDRPSAFITRRPNEFRQGRWETEVRFDTERLCTRPDGKCWFRIEVRR*
Ga0134125_1073046613300010371Terrestrial SoilTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGEECWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLTALVPRPPAQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRR*
Ga0134122_1000727313300010400Terrestrial SoilAAGTSGCCHYNKGVCGCEDGKPRCCDGKVSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0137389_1046826723300012096Vadose Zone SoilARCCDGKVSASCACTDKPLTREITVDAQSPLGLADFAFAGHESPEPPSPRLTLFRLGADALRFWFKLDCGDDCWGRLAVNGQLPLEVRWLFDPGSGPMLDGNPQTVVLQRNRHSVFVARPVSQLRHGRWETEVRFDTERLCTRGDDRCWFRVEVRR*
Ga0137388_1015411813300012189Vadose Zone SoilMATPVRATKRVMLVLVTLGLGLAGWTGPSRPGDAGRCGVAPAAAASSGGCCHYNMGVCNCEGGRARCCDGKVSASCACTDKPLTREITVDAQSPLGLADFAFASQEFPEPPSPRLSWFRLGADALRFWFKLDCWDDCWARLAVNGQLPLEVHWLFDPGSGPMLDGNPQTVVLQRNRHSVFVARPVSQLRHGRWETEVRFDTERLCTRGDDRCWFRVEVRR*
Ga0137404_1012434023300012929Vadose Zone SoilMRRRLTTAVLVTLALGLGTWLAAPLAGSDGACVVPAAAAAGTSGCCHYNKGVCGCDNGRARCCDGKVSASCRCNSGLTTRQISIDTDPILSLADVAFAARDVPEPPSPRLTLFRLGPDPLRFWFRLNCGPECWSQLAVKDALPLEVRWLFDPGSGPVLEGDPQPITLPRKRPAVFVSRPPSQLREGRWETEVRFDTERLCIRGDEKCWFRVEVRR*
Ga0137407_1009783823300012930Vadose Zone SoilMQRRLTTAVLVTLALGLGTWLAAPLAGSDGACVVPAAAAAGTSGCCHYNKGVCGCDNGRARCCDGKVSASCRCNSGLTTRQISIDTDPILSLADVAFAARDVPEPPSPRLTLFRLGPDPLRFWFRLNCGPECWSQLAVKDALPLEVRWLFDPGSGPVLEGEPQPITLPRKRPAVFVSRPPSQLREGRWETEVRFDTERLCIRGDEKCWFRVEVRR*
Ga0157375_1021197933300013308Miscanthus RhizosphereCEDGKPRCCDGKVSASCRCGSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK*
Ga0075313_114712913300014267Natural And Restored WetlandsAGTAGCCHYNKGVCGCESGRARCCDGKVSASCRCGGSGVTTRQIRIDTEPLVSLADFAFASQETPEPPSPRLTLFRLGPDPLRFWFKLSCGEECWRQLAVDGALPLEVRWLFDPGSGPVLEGDPQRVTLQRDHPAVFVTRPPTQLRQGRWETEVRLDTERLCTRGDARCWFRIEVRR*
Ga0075327_104131923300014272Natural And Restored WetlandsRCCDGKVSASCRCGGSGVTTRQIRIDTEPLVSLADFAFASQETPEPPSPRLTLFRLGPDPLRFWFKLSCGEECWRQLAVDGALPLEVRWLFDPGSGPVLEGDPQRVTLQRDHPAVFVARPPTQLRQGRWETEVRLDTERLCTRGDARCWFRIEVRR*
Ga0075310_111801013300014302Natural And Restored WetlandsGMRRRLTTLVLATLALGVIAWLAGPLAGSGGSCLVPAASAAGRAGCCHYNRGVCGCQNGRARCCDGKVSASCRCNAGLTTRQIGIATEPLVSLADVAFARQDMPEPPSPRLTLFRLGADPLRFWFKLDCGPECWNQLAVDNVLPLEVRWLFDPGSGPVVDGDPQRVTLLRDRPTVFVARPPSQLRQGRWETE
Ga0132258_1289133713300015371Arabidopsis RhizosphereATLGLGAMTWSSGSVPGDPGSCGVTPAAAAGSAGCCHYNKGVCSCKDGTPTCCDGKVSASCRCGGITTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQSIMLPRNRSTVFVSRPPTQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR*
Ga0163161_1100179613300017792Switchgrass RhizosphereMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTPAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQ
Ga0190265_1167615213300018422SoilRDREAHRMRRRLTTAALLALALGGAAWAAGSILVTCAVPDASAAGTQGCCHYNKGVCGCEGGRARCCDGKVSASCRCSSGLTTRQISIDTQPLVRLSDFAFASAELPEPPSPRLTLFRLGAEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPGDSKCWFRIEVRR
Ga0190270_1159331413300018469SoilLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVAEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPGDGKCWFRIEVRR
Ga0184646_148090213300019259Groundwater SedimentNKGVCGCEGGRARCCDGKVSASCRCSSGLPTRQISIDTQPLVRLADFAFASAELPEPPSPRLTLFRLGADALRFWFRIDCGEECWKQLSVDGALPVEVRWLFDPGGGPVVEGPPQPVALRRDRLAVFVPRTPKQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRQ
Ga0190264_1161366413300019377SoilNAGLTTRQISIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVAEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPGDGKCWFRIEVRR
Ga0193755_100291933300020004SoilMRRRLTTAVLVTLALGLGTWLAAPLAGSDGACVVPAAAAAGTSGCCHYNKGVCGCDNGRARCCDGKVSASCRCNSGLTTRQISIDTDPILSLADVAFAARDMPEPPSPRLTLFRLGPDPLRFWFRLNCGPECWSQLAVKDALPLEVRWLFDPGSGPVLEGDPQPITLPRNRPAVFVSRPPSQLREGRWETEVRFDTERLCIRGDEKCWFRVEVRR
Ga0210379_1004556533300021081Groundwater SedimentCEGGRARCCDGKVSASCRCSSGLPTRQISIDTQPLVRLADFAFASAELPEPPSPRLTLFRLGADALRFWFRVDCGEECWKQLSVDGALPVEVRWLFDPGSGPVVEGPPQPVALRRDRLAVFVPRPPKQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRQ
Ga0207654_1020902313300025911Corn RhizospherePGTGGGCAISPADAAGTSGCCHYNKGVCGCEDGKPRCCDGKVSASCRCGSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0207706_1145734813300025933Corn RhizosphereYNKGVCGCEGGRARCCDGKVSASCRCNSGLTTRQISYDTQPLIRLADFAFAGQELPEPPSPRLTLFRLGADALRFWFRLDCSEDCWSQLSANDALPVEVRWLFDPGSGPVVEGPAQPIALRRDRLAAFVPRPPTQLRQGRWETEVRFDTERLCTRADGKCWFRIEVRR
Ga0207668_1047969513300025972Switchgrass RhizosphereYNKGVCGCEDGKPRCCDGKVSASCRCGSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0209819_1013994123300027722Freshwater SedimentYNTGVCGCESGRARCCDGKVSASCRCGGSGVTTRQIRIDTEPLVSLADFAFATQETPEPPSPRLTLFRLGPDPLRFWFKLSCGEECWRQLAVDGVLPLEVRWLFDPGGGPVLEGAPQRVTLQRDNPTVFVARPPTQLRQGRWETEVRLDTERLCTRGDARCWFRIEVRR
Ga0207428_1014611723300027907Populus RhizosphereMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0209382_1014525433300027909Populus RhizosphereIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR
Ga0268265_1043164913300028380Switchgrass RhizosphereEDGKPRCCDGKVSASCRCGSEKFTTRQISVDTQPLISLADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVTLQRDRSTLFVTRPASQLRLERWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0247828_1011156023300028587SoilMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCSGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0247822_1189581813300028592SoilLPGVDGGCAVPAAAAGCCHYNKGVCGCEQGRARCCDGKISASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVAEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFVTG
Ga0247821_1086730313300028596SoilCHYNKGVCGCEQGRARCCDGKTSASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPADGKCWFRIEVRR
Ga0247819_1102390613300028608SoilKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0307305_1044404113300028807SoilLGLGTWLAAPLAGSDGACVVPAAAAAGTSGCCHYNKGVCGCDNGRARCCDGKVSASCRCNSGLTTRQISIDTDPILSLADVAFAARDMPEPPHPRLTLFRLGPDPLRFWFRLNCGPECWSQLAVKDALPLEVRWLFDPGSGPVLEGDPQPITLPRNRPAVFVSRPPSQLREGRWETEVRFDTERLCIRGDEKCW
Ga0247824_1037055513300028809SoilNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0247824_1053395213300028809SoilTAWFAGAVAGTDGGCLVPAASAAGSAGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR
Ga0247825_1000353463300028812SoilMRRRLTTLGLVTLALGVTAWFAGAVAGTDGGCLVPAASAAGSTGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR
Ga0307302_1070340713300028814SoilESGRARCCDGKVSASCRCGGGLTTRQIKIDTEPLLSVADFAFASQDMPEPPSARLTLFRLGADPLRFWFRLNCSPECWTQLAVNGALPLEVRWLFDPGSGPALEGDPQPVVLQRDKPTVFVARPPSQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRR
Ga0307296_1066858713300028819SoilGSIPGIDGNCPVPAASAAGTEGCCHYNKGVCGCESGRARCCDGKVSASCRCGGGLTTRQIKIDTEPLLSVADFAFASQDMPEPPSARLTLFRLGADPLRFWFRLNCSPECWTQLAVNGALPLEVRWLFDPGSGPALEGDPQPVVLQRDKPTVFVARPPSQLRQGRWETEVRFDTERLCTRGDGKCWFRI
Ga0247827_1010980623300028889SoilQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0299907_1007963223300030006SoilMTRRLTTVALVTLALGVTAWIAGPPGGRDGRCLVPAAEAAGSSGCCHYNQGVCGCESGRARCCDGKVSASCRCRSGLATRQIRVDAEPLVSVADFAFASREEPEPPSPRLTLFRLAAEPLRFWFRLNCGPECWSLLAVDGVLPLEVRWLFDPGSGPTLEGEPQPITLQRDRPAVFVTRPPGQLRQGRWETEVRFDTERLCMRGDSRCWFRIEVRR
Ga0299907_1063533613300030006SoilRARCCDGKVSASCRCRSGLPTRQIRIDAEPLVSLADFAFASQDTPEPPSPRLTLFRLGADPLQFWFRLNCGPECWSLLAVDGVLPLEVRWLFDPGSGPTLEGDPQTITLQRDRSAVFVARPPSQLRQGRWETEVRFDTERLCLRGDAKCWFRVEVRR
Ga0247826_1010161523300030336SoilMRRRLTTLGLVTLALGVTAWFAGAVAGTDVGCLVPAASAAGSAGCCHYNRGVCGCESGRARCCDGKVSASCRCNAGLTTRQIRIDTEPLVSVADFAFASQDTPEPPSPRLTLFRLAADPLRFWFRLNCGPECWKLLAVDGTLPLEVRWLFDPGSGPALEGDPQSVTLQRDRPAVFVARAPGQLRQGRWETEVRFDTERLCTRGDSKCWFQIEVRR
Ga0268386_1006408033300030619SoilTASAAGTAGCCHYNKGVCGCESGRARCCDGKVSASCRCGGSGVTTRQIRIDTEPLVSLADFAFASQETPEPPSPRLTLFRLGPDPLRFWFKLSCGEECWRQLAVDGALPLEVRWLFDPGGGPVLEGAPQRVTLQRDRPAVFVARPPTQLRQGRWETEVRLDTERLCTRGDARCWFRIEVR
Ga0268386_1040851523300030619SoilMRRRLTTVVLLALSLGVVAWLAGPVGGDDAGCLVPAAAAAGSAGCCHYNRGVCGCESGRARCCDGKVSASCRCQSGLSTRQIRIDAEPLVSVADFAFASQESPEPPSPRLTLFRLGADPLRFWFRLNCGPECWSQLAVDGALPLEVRWLFDPGGGPTLEGEPQRITLPRDRPAMFVTRAPGQLRQGRWETEVRFDTERLCLQGDSTCWFRIEVRR
Ga0307500_1030468613300031198SoilGGSLPGDPGTCAVSPAAAAGTSGCCHYNKGVCGCEDGKPRCCDGKVSASCRCGSGNVTTRQISVETQPLISVADFAFASQEMEPPNPRLTLFRLASEPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWE
Ga0307469_1101683413300031720Hardwood Forest SoilTGGGCAISPADAAGTSGCCHSNKGVCGCEDGKPRCCDGKVSASCRCGSEKFTTRQIIVDTQPLISVADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVALQRNRSTIFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0307468_10008570833300031740Hardwood Forest SoilKVSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0307468_10012578423300031740Hardwood Forest SoilMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTPAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0307468_10145728113300031740Hardwood Forest SoilTDPLLSLADFAFASQEMPEPPSTRLTLFRLGADPLRFWFRLNCGPECWTQLSVNGGLPVEVRWLFDPGSGPALEGEPQQIALQRDKPAVFVARPPRQLRQGRWETEVRYDTERLCTRGDGKCWFRIEVRR
Ga0310907_1066510823300031847SoilGRARCCDGKVSASCRCNAGLTTRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR
Ga0307410_1099137413300031852RhizosphereASGLTTRQIRIDTEPLVSLADFAFASQETPEPPSPRLTLFRLGSDPLRFWFRLNCGPECWTQLAVDGVLPVEVRWLFDPGSGPALEGDPQPVALQRERLTAFVPRPPKQLRQGRWETEVRFDTERLCTRGDSKCWFRIEVQR
Ga0310892_1140028013300031858SoilSPAEAAGTSGCCHYNKGVCGCEDGKPRCCDGKVSASCRCGSGSFTTRQISVDTQPLISVADFAFASQEMEPPNPRLTLFRLARDPLRFWFRLDCGDECWSRLAVDGALPLEVRWLFDPGSGPLLEGAPQTIKLPRDRSTVFVARPVNQLRQGRWETEVRFDTERLCT
Ga0310900_1010691313300031908SoilGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0310885_1011173513300031943SoilAGLTTRQVSYDTQPLVRLADFAFASQELPEPPSPRLTLFRLGADALRFWFRLDCGEECWNQLSVNGALPLEVRWLFDPGSGPVVDGPTQPVTLQRDRLAAFVPRPPAQLRQGRWETEVRFDTERLCTRADGRCWFRIEVRR
Ga0310890_1108582413300032075SoilSCGVTAAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCSGVTTRQINIDTQPLISVADFAFASMEAPEPPSPRLTLFRLGADALRFWFRLDCNEECWNRLAVDGSLPLEVRWLFDPGSGPLLDGAPQTIMLPRNRSTVFVARPANQLRLGRWETEVRFDTERLCTRGDDRCWFRIQVQR
Ga0307470_1049996623300032174Hardwood Forest SoilMSLTKRAIMVLATLGLGAMTWSSGSLPGDPGSCGVTPAAAAGSAGCCHYNKGVCSCQDGKPTCCDGKVSASCRCGSEKFTTRQISVDTQPLISVADFAFATQETPEPPSPRLTLFRLGRDPLRFWFRVDCGDECWERLAVDGALPLQVRWLFDPGSGPLLEGPAQSVALQRNRSTIFVTRPASQLRLGRWETEVRFDTERLCTRGDDKCWFRIQVQK
Ga0335080_1030678133300032828SoilGCAVSPADAAGTSGCCHYNKGVCGCEDGKPRCCDGKVSASCRCGNITTRQITIDTQPLISVADFAFARQEAPEPPSPRLTLFRLGSDALRFWFRLDCGEECWSRLAVDGALPLEVRWLFDPGSGPLLDGEPQTIMLPRNRSTVFVARPANLLRQGRWETEVRFDTERLCTRGDEKCWFRIQVQK
Ga0247830_1135617613300033551SoilQGRARCCDGKISASCRCNAGLTTRQINIDTQPLVRLADFAFAAQEVPEPPSPRLTLFKLGKEALRFWFRVDCGEECWSQLAVNNALPVEVRWLFDPGAGPVVEGEPQAVALQRDRPTAYVTRMANQLRQGRWETEVRFDTERLCTPADGKCWFRIEVRR
Ga0364946_168981_2_4153300033815SedimentTRQISIDTQPLVRLADFAFASAELPEPPSPRLTLFRLGADALRFWFRVDCGEECWKQLSVDGALPVEVRWLFDPGSGPVVEGPPQPVALRRDRLAVFVPRPPKQLRQGRWETEVRFDTERLCTRGDGKCWFRIEVRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.