NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106126

Metagenome / Metatranscriptome Family F106126

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106126
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 45 residues
Representative Sequence VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQA
Number of Associated Samples 85
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.00 %
% of genes near scaffold ends (potentially truncated) 94.00 %
% of genes from short scaffolds (< 2000 bps) 87.00 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(22.000 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.52%    β-sheet: 0.00%    Coil/Unstructured: 46.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF04264YceI 23.00
PF12681Glyoxalase_2 12.00
PF13302Acetyltransf_3 7.00
PF08281Sigma70_r4_2 6.00
PF00903Glyoxalase 5.00
PF07883Cupin_2 5.00
PF00891Methyltransf_2 4.00
PF07687M20_dimer 3.00
PF02738MoCoBD_1 3.00
PF16864Dimerisation2 3.00
PF00583Acetyltransf_1 1.00
PF05977MFS_3 1.00
PF01546Peptidase_M20 1.00
PF01627Hpt 1.00
PF00665rve 1.00
PF00355Rieske 1.00
PF01594AI-2E_transport 1.00
PF00296Bac_luciferase 1.00
PF13683rve_3 1.00
PF07690MFS_1 1.00
PF13378MR_MLE_C 1.00
PF03793PASTA 1.00
PF08543Phos_pyr_kin 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 23.00
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 1.00
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 1.00
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.00
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.00
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 1.00
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.00
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.00
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.00
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 1.00
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.00
COG4584TransposaseMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.00 %
UnclassifiedrootN/A2.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001431|F14TB_101448527All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300002558|JGI25385J37094_10003450All Organisms → cellular organisms → Bacteria → Proteobacteria5417Open in IMG/M
3300002560|JGI25383J37093_10000614All Organisms → cellular organisms → Bacteria → Proteobacteria8800Open in IMG/M
3300002561|JGI25384J37096_10006959All Organisms → cellular organisms → Bacteria → Proteobacteria4209Open in IMG/M
3300002561|JGI25384J37096_10022401All Organisms → cellular organisms → Bacteria2462Open in IMG/M
3300002562|JGI25382J37095_10005539All Organisms → cellular organisms → Bacteria4480Open in IMG/M
3300005177|Ga0066690_11024616All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300005180|Ga0066685_10087827All Organisms → cellular organisms → Bacteria → Proteobacteria2061Open in IMG/M
3300005181|Ga0066678_10655415All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300005181|Ga0066678_11103038All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300005441|Ga0070700_100369584All Organisms → cellular organisms → Bacteria → Proteobacteria1069Open in IMG/M
3300005446|Ga0066686_11001879All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300005454|Ga0066687_10396154All Organisms → cellular organisms → Bacteria → Proteobacteria798Open in IMG/M
3300005459|Ga0068867_100474853All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300005468|Ga0070707_100252172All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300005468|Ga0070707_100376870All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300005540|Ga0066697_10705905All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria552Open in IMG/M
3300005546|Ga0070696_100573737All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005546|Ga0070696_100593008All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005546|Ga0070696_101779778All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300005552|Ga0066701_10411494All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300005555|Ga0066692_10449952All Organisms → cellular organisms → Bacteria → Proteobacteria820Open in IMG/M
3300005555|Ga0066692_10560444All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300005557|Ga0066704_10667979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium658Open in IMG/M
3300005557|Ga0066704_10941795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium533Open in IMG/M
3300005559|Ga0066700_10935969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria574Open in IMG/M
3300005578|Ga0068854_101614295All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005586|Ga0066691_10607336All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005764|Ga0066903_102559379All Organisms → cellular organisms → Bacteria → Proteobacteria989Open in IMG/M
3300005844|Ga0068862_100756394All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola thiotaurini946Open in IMG/M
3300005981|Ga0081538_10315390All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300006034|Ga0066656_10431760All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300006574|Ga0074056_10872613All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium729Open in IMG/M
3300006794|Ga0066658_10834766All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300006796|Ga0066665_11667532All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium504Open in IMG/M
3300006797|Ga0066659_11668876All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006844|Ga0075428_100949710All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300006846|Ga0075430_101164871All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium635Open in IMG/M
3300006847|Ga0075431_101433461All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300006854|Ga0075425_101291341All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300007255|Ga0099791_10424211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300009088|Ga0099830_10089374All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300009147|Ga0114129_12545012All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium611Open in IMG/M
3300009156|Ga0111538_10657299All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1329Open in IMG/M
3300009157|Ga0105092_10305482All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium898Open in IMG/M
3300010329|Ga0134111_10303848All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium665Open in IMG/M
3300010379|Ga0136449_103839965Not Available564Open in IMG/M
3300010398|Ga0126383_13192345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300010401|Ga0134121_10988784All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola thiotaurini825Open in IMG/M
3300011270|Ga0137391_10071650All Organisms → cellular organisms → Bacteria2979Open in IMG/M
3300011270|Ga0137391_10519731All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1006Open in IMG/M
3300011443|Ga0137457_1351020All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300012203|Ga0137399_11400384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium585Open in IMG/M
3300012208|Ga0137376_11373489All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300012355|Ga0137369_10059004All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300012360|Ga0137375_10361087All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1285Open in IMG/M
3300012685|Ga0137397_10382071All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300012918|Ga0137396_10234590All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300012918|Ga0137396_10740541All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012922|Ga0137394_11148064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium641Open in IMG/M
3300012922|Ga0137394_11332310All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300014154|Ga0134075_10122726All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300014501|Ga0182024_10341005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1962Open in IMG/M
3300015251|Ga0180070_1068247All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium504Open in IMG/M
3300018469|Ga0190270_12733713All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300019882|Ga0193713_1057625All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300020004|Ga0193755_1054431All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300020221|Ga0194127_10177591All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300022534|Ga0224452_1082396All Organisms → cellular organisms → Bacteria976Open in IMG/M
(restricted) 3300023208|Ga0233424_10080901All Organisms → cellular organisms → Bacteria → Proteobacteria1437Open in IMG/M
3300026075|Ga0207708_10619698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria918Open in IMG/M
3300026295|Ga0209234_1128363All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300026335|Ga0209804_1038701All Organisms → cellular organisms → Bacteria2382Open in IMG/M
3300026351|Ga0257170_1010805All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1130Open in IMG/M
3300026360|Ga0257173_1003966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1445Open in IMG/M
3300026497|Ga0257164_1014331All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300026514|Ga0257168_1152257All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria515Open in IMG/M
3300026524|Ga0209690_1038965All Organisms → cellular organisms → Bacteria → Proteobacteria2213Open in IMG/M
3300026538|Ga0209056_10442561Not Available750Open in IMG/M
3300026538|Ga0209056_10620234All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium545Open in IMG/M
3300027637|Ga0209818_1088897All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium803Open in IMG/M
3300027655|Ga0209388_1160606All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300027722|Ga0209819_10277437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium579Open in IMG/M
3300027821|Ga0209811_10081029All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300027880|Ga0209481_10109043All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300027905|Ga0209415_10089459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3465Open in IMG/M
3300027909|Ga0209382_11958018All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300028673|Ga0257175_1010002All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300028673|Ga0257175_1015555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1211Open in IMG/M
3300031226|Ga0307497_10025446All Organisms → cellular organisms → Bacteria1876Open in IMG/M
3300031548|Ga0307408_100786272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300031720|Ga0307469_11482386All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300031720|Ga0307469_11684986All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium611Open in IMG/M
3300031908|Ga0310900_10063573All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300032174|Ga0307470_11768206All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300032180|Ga0307471_101628217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium801Open in IMG/M
3300032180|Ga0307471_102444127All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium660Open in IMG/M
3300032205|Ga0307472_100166863All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300032205|Ga0307472_101110562All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium749Open in IMG/M
3300033433|Ga0326726_12026716All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F14TB_10144852713300001431SoilVNKNIRLLYGFSFFDPFMIVIPVWVPYLATQGITMRQFMELQ
JGI25385J37094_1000345013300002558Grasslands SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVF
JGI25383J37093_1000061493300002560Grasslands SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ
JGI25384J37096_1000695913300002561Grasslands SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA
JGI25384J37096_1002240113300002561Grasslands SoilVNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA
JGI25382J37095_1000553913300002562Grasslands SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMEL
Ga0066690_1102461623300005177SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQ
Ga0066685_1008782713300005180SoilMSNGHDGPAPVEKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQ
Ga0066678_1065541523300005181SoilVKRNIALLYGFSFFDQFMIVIALWVPYLTTQGIGMRQFMELQAVFALVILC
Ga0066678_1110303813300005181SoilVKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQ
Ga0070700_10036958423300005441Corn, Switchgrass And Miscanthus RhizosphereVAVKKNIPLLYGFSFFDQFMIVIPVWVPYLASQGINMRQFMELQAGFALVILCGEV
Ga0066686_1100187913300005446SoilVKKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVILC
Ga0066687_1039615413300005454SoilVKRNIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFMELQAMFALVILAGEVPS
Ga0068867_10047485333300005459Miscanthus RhizosphereVKQNIKLLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQ
Ga0070707_10025217213300005468Corn, Switchgrass And Miscanthus RhizosphereVKKNIALLYGFSFSDQFMIVIALWVPYLTTQGISMRQFMEL
Ga0070707_10037687013300005468Corn, Switchgrass And Miscanthus RhizosphereMSNGHDGPAPVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQAVFALVIL
Ga0066697_1070590523300005540SoilVNTNIRLLYGFSFFDPFMIVIPVWVPYLATLGITMRQFMELQAVFALVILCGE
Ga0070696_10057373733300005546Corn, Switchgrass And Miscanthus RhizosphereVNRNIKLLYGFAFFDQFMIVIALWIPYLTTQGITMRQFMELQAVF
Ga0070696_10059300813300005546Corn, Switchgrass And Miscanthus RhizosphereLKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFAIVILSGE
Ga0070696_10177977823300005546Corn, Switchgrass And Miscanthus RhizosphereVAVKKNIPLLYGFSFFDQFMIVIPVWVPYLATQGINMRQFMELQA
Ga0066701_1041149413300005552SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFM
Ga0066692_1044995223300005555SoilVNTNIRLLYGFSFFDPFMIVIPVWVPYLLTQGITMRQFMEL
Ga0066692_1056044433300005555SoilVKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQAVFA
Ga0066704_1066797933300005557SoilLKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM
Ga0066704_1094179513300005557SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISM
Ga0066700_1093596923300005559SoilVNTNIKLLYGFSFFDPFMIVIPVWVSYLATQGRPAIRRP
Ga0068854_10161429513300005578Corn RhizosphereLKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALV
Ga0066691_1060733623300005586SoilVKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQA
Ga0066903_10255937913300005764Tropical Forest SoilMHAAVKKNIPLLYGFAFVDQCMIVIAVWVPYLATQGIGMRQFMELQAV
Ga0068862_10075639423300005844Switchgrass RhizosphereVAVKKNIPLLYGFSFFDQFMIVIPVWVPYLATQGINM
Ga0081538_1031539023300005981Tabebuia Heterophylla RhizosphereVNTNIRLLYGFSFFDPFMIVIPLWVPYLATQGITMRQFMELQALFAI
Ga0066656_1043176013300006034SoilVNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVILCGE
Ga0074056_1087261313300006574SoilVKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFME
Ga0066658_1083476623300006794SoilVTRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ
Ga0066665_1166753233300006796SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQF
Ga0066659_1166887613300006797SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQA
Ga0075428_10094971013300006844Populus RhizosphereVNRNVKLLYGFSFFDQFMIVIALWIPYLTTQGIAMRQFMELQAVFAIVILS
Ga0075430_10116487123300006846Populus RhizosphereMKKNIPLLYGFTFFDQFMIVIALWVPYLTTQGISMRQFMELQAVF
Ga0075431_10143346113300006847Populus RhizosphereVKKNVALLYGFSFLDQFMIVIALWVPYLATLGIGMRQFMELQAVFAIVIL
Ga0075425_10129134133300006854Populus RhizosphereVNRNVKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVILSGEV
Ga0099791_1042421123300007255Vadose Zone SoilVKRNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQAIFAIVILCG
Ga0099830_1008937433300009088Vadose Zone SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG*
Ga0114129_1254501223300009147Populus RhizosphereVNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVIL
Ga0111538_1065729923300009156Populus RhizosphereMKKNIALLYGFSFFDQFMILIALWVPYLATQGIGMRQFMELQAVFALVIL*
Ga0105092_1030548233300009157Freshwater SedimentVNKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ
Ga0134111_1030384823300010329Grasslands SoilVNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQ
Ga0136449_10383996513300010379Peatlands SoilVKNNIRLLYGFSFFDQFMIVIPLLVPYLATKGIGM
Ga0126383_1319234513300010398Tropical Forest SoilMHAAVKKNIPLLYGFAFVDQCMIVIAVWVPYLATQGIGMRQFMELQAVFAIVILCGEV
Ga0134121_1098878413300010401Terrestrial SoilVAVKKNILLLYGFSFFDQFMIVIPVWVPYLATQGINMRQFMEL
Ga0137391_1007165013300011270Vadose Zone SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALV
Ga0137391_1051973123300011270Vadose Zone SoilVKKSIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFMEMQ
Ga0137457_135102013300011443SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA
Ga0137399_1140038413300012203Vadose Zone SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFME
Ga0137376_1137348933300012208Vadose Zone SoilVKRNIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFM
Ga0137369_1005900453300012355Vadose Zone SoilVKRNIPLLYGFSFFDQFMIVIALWVPYLTTQGISMR*
Ga0137375_1036108713300012360Vadose Zone SoilVKKNITLLYGFSCFDQFMIVIALWVPYLATKGIGMR
Ga0137397_1038207133300012685Vadose Zone SoilVKKNIPLLYGFSFFDQFMIVIALWVPYLTTQGISMRQFM
Ga0137396_1023459013300012918Vadose Zone SoilVKKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMEL
Ga0137396_1074054133300012918Vadose Zone SoilLKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ
Ga0137394_1114806423300012922Vadose Zone SoilVKKNIPLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM
Ga0137394_1133231013300012922Vadose Zone SoilVNTNIRLLYGFSFFDPFMIVIPMWVPYLATLGITMRQFMELQAVFALVIL
Ga0134075_1012272633300014154Grasslands SoilVNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVIL
Ga0182024_1034100513300014501PermafrostVIGRVKNNIRLLYGFSFFDQFMIVIPLLVPYLATKGISMAQFM
Ga0180070_106824713300015251SoilVKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMR*
Ga0190270_1273371323300018469SoilVKRNIKLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFAVVILCG
Ga0193713_105762533300019882SoilVNENIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVIL
Ga0193755_105443133300020004SoilMKRNIPLLYGFSCFDQFMIVIAVWVPYLATQGIGISLAQL
Ga0194127_1017759113300020221Freshwater LakeVNRNVKLLYSFSFFNPFMIVIPLWVPYLATHGITMR
Ga0224452_108239613300022534Groundwater SedimentVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGVSMRQFMELQ
(restricted) Ga0233424_1008090123300023208FreshwaterLKKNIKLLYGFSFFDQFMIVIPLLVPYLGTKEIGMGQFMEL
Ga0207708_1061969823300026075Corn, Switchgrass And Miscanthus RhizosphereVAVKKNIPLLYGFSFFDQFMIVIPVWVPYLASQGINMRQFMELQAGFALVILCGEVPTG
Ga0209234_112836313300026295Grasslands SoilVNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGM
Ga0209804_103870113300026335SoilMTKNIPLLYGFSFFDQFMIVIASWVPYLATQGIGMRQ
Ga0257170_101080523300026351SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG
Ga0257173_100396643300026360SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPG
Ga0257164_101433113300026497SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAG
Ga0257168_115225713300026514SoilAVAAVNRNINLLYGFSFFDPFMIVIPVFVPYLATNGISMRQFMELQDAS
Ga0209690_103896513300026524SoilMSNGHDGPAPVKKNIALLYGFSFFDQFMIVIALWVPYLATQGISMRQFMELQAVFA
Ga0209056_1044256113300026538SoilVKNNIALLYGFSFFDQFMIVIALWIPYLATQGISMRQFMELQA
Ga0209056_1062023413300026538SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQAVF
Ga0209818_108889713300027637Agricultural SoilMKKNIPLLYGFSFFDQFMIVIALWVPYLATQGISMRQFM
Ga0209388_116060623300027655Vadose Zone SoilVNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFAIV
Ga0209819_1027743723300027722Freshwater SedimentVNKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAMF
Ga0209811_1008102913300027821Surface SoilVNRNIKLLYGFAFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVI
Ga0209481_1010904333300027880Populus RhizosphereMKKNIALLYGFSFFDQFMILIALWVPYLATQGIGMRQFMELQAVFALV
Ga0209415_1008945943300027905Peatlands SoilVKNNLRLLYGFSFVDQFMIVIPLWVPYLATKGISMAQFMQLQAIFALVIV
Ga0209382_1195801813300027909Populus RhizosphereLKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVIL
Ga0257175_101000233300028673SoilVKKNITLLYGFSFFDQFMIVIALWVPYLATHGIGMR
Ga0257175_101555513300028673SoilRHPGRSPGLRPVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG
Ga0307497_1002544613300031226SoilVNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFME
Ga0307408_10078627213300031548RhizosphereVKKNIPLLYGFSFFDQFMIVIALWVPYLATQGISM
Ga0307469_1148238633300031720Hardwood Forest SoilMKRNISLLYGFSFFDQFMIVIALWVPYLAAQGIGMRQFMELQAVFAIV
Ga0307469_1168498613300031720Hardwood Forest SoilVKKNIALLYGFSFLDQFMIVIALWVPYLATKGIGMRQFMEL
Ga0310900_1006357313300031908SoilVKQNIKLLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMEL
Ga0307470_1176820613300032174Hardwood Forest SoilVNRNIKLLYGFSFFDPFMIVIPVWVPYLATQGITMRQFMELQA
Ga0307471_10162821713300032180Hardwood Forest SoilVNRNIKLLYGFSFFDQFMNVIALWVPYLATKGIGMR
Ga0307471_10244412713300032180Hardwood Forest SoilVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGMSMRQFMEL
Ga0307472_10016686343300032205Hardwood Forest SoilVNKNVRLLYGFSFFDPFMIVIPVWVPYLATQGITMRQF
Ga0307472_10111056223300032205Hardwood Forest SoilMTKNIPLLYGFSFFDQFMIHIAVWVPYLTTQGIGMRQFMELQAAFALVILCGE
Ga0326726_1202671623300033433Peat SoilVKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.