Basic Information | |
---|---|
Family ID | F106025 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 40 residues |
Representative Sequence | FLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.00 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.00 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF03473 | MOSC | 41.00 |
PF01715 | IPPT | 30.00 |
PF13520 | AA_permease_2 | 10.00 |
PF06441 | EHN | 2.00 |
PF02416 | TatA_B_E | 1.00 |
PF07690 | MFS_1 | 1.00 |
PF06745 | ATPase | 1.00 |
PF04203 | Sortase | 1.00 |
PF00561 | Abhydrolase_1 | 1.00 |
PF00072 | Response_reg | 1.00 |
PF01184 | Gpr1_Fun34_YaaH | 1.00 |
PF16640 | Big_3_5 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 30.00 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 2.00 |
COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 1.00 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 1.00 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.00 % |
Unclassified | root | N/A | 26.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005843|Ga0068860_101514055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 692 | Open in IMG/M |
3300006028|Ga0070717_10457666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
3300006028|Ga0070717_10764421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
3300006162|Ga0075030_101315299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
3300006163|Ga0070715_10016367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2785 | Open in IMG/M |
3300006173|Ga0070716_100438988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
3300006175|Ga0070712_100013417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 5237 | Open in IMG/M |
3300006755|Ga0079222_10472144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
3300006806|Ga0079220_10454117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
3300006953|Ga0074063_14020543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
3300009148|Ga0105243_10115817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2251 | Open in IMG/M |
3300009162|Ga0075423_11338057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300009545|Ga0105237_12621693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300010043|Ga0126380_12125491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300010371|Ga0134125_10463573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
3300010379|Ga0136449_101456373 | Not Available | 1052 | Open in IMG/M |
3300010379|Ga0136449_104242756 | Not Available | 531 | Open in IMG/M |
3300010399|Ga0134127_12831605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300010403|Ga0134123_10076851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2588 | Open in IMG/M |
3300010866|Ga0126344_1377385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300010880|Ga0126350_11705843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1351 | Open in IMG/M |
3300012200|Ga0137382_10296784 | Not Available | 1127 | Open in IMG/M |
3300012285|Ga0137370_10446631 | Not Available | 787 | Open in IMG/M |
3300012351|Ga0137386_10320181 | Not Available | 1116 | Open in IMG/M |
3300012356|Ga0137371_10015427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 5872 | Open in IMG/M |
3300012359|Ga0137385_10247140 | Not Available | 1546 | Open in IMG/M |
3300012927|Ga0137416_11919273 | Not Available | 542 | Open in IMG/M |
3300012958|Ga0164299_10090368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1564 | Open in IMG/M |
3300013100|Ga0157373_10942136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300013102|Ga0157371_10917583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
3300013307|Ga0157372_10694958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
3300014325|Ga0163163_10347539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1539 | Open in IMG/M |
3300016294|Ga0182041_12337581 | Not Available | 500 | Open in IMG/M |
3300016319|Ga0182033_10748112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 858 | Open in IMG/M |
3300017821|Ga0187812_1053642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1354 | Open in IMG/M |
3300017822|Ga0187802_10110521 | Not Available | 1037 | Open in IMG/M |
3300017926|Ga0187807_1278192 | Not Available | 553 | Open in IMG/M |
3300017948|Ga0187847_10214731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
3300017995|Ga0187816_10051209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1726 | Open in IMG/M |
3300018042|Ga0187871_10745970 | Not Available | 545 | Open in IMG/M |
3300018468|Ga0066662_12921406 | Not Available | 507 | Open in IMG/M |
3300019356|Ga0173481_10501054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300020581|Ga0210399_10696294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
3300021171|Ga0210405_10049159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3339 | Open in IMG/M |
3300021181|Ga0210388_11156485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
3300021181|Ga0210388_11216984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
3300021374|Ga0213881_10150070 | Not Available | 1021 | Open in IMG/M |
3300021374|Ga0213881_10185334 | Not Available | 917 | Open in IMG/M |
3300021401|Ga0210393_10393590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1129 | Open in IMG/M |
3300021401|Ga0210393_10592166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
3300022521|Ga0224541_1015254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mimosae | 827 | Open in IMG/M |
3300022720|Ga0242672_1111973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300025928|Ga0207700_11908975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
3300025929|Ga0207664_11962085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300027030|Ga0208240_1043439 | Not Available | 508 | Open in IMG/M |
3300027857|Ga0209166_10322185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
3300027869|Ga0209579_10781745 | Not Available | 516 | Open in IMG/M |
3300028747|Ga0302219_10146355 | Not Available | 904 | Open in IMG/M |
3300028759|Ga0302224_10222693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
3300028775|Ga0302231_10240768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300028789|Ga0302232_10421440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
3300028789|Ga0302232_10516159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300028876|Ga0307286_10282598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
3300028877|Ga0302235_10296794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
3300030007|Ga0311338_10889284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
3300030013|Ga0302178_10061581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2023 | Open in IMG/M |
3300030043|Ga0302306_10278717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300030520|Ga0311372_10545386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1681 | Open in IMG/M |
3300030520|Ga0311372_10999602 | Not Available | 1105 | Open in IMG/M |
3300030743|Ga0265461_11559174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
3300031198|Ga0307500_10239249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300031233|Ga0302307_10135861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
3300031546|Ga0318538_10692388 | Not Available | 553 | Open in IMG/M |
3300031679|Ga0318561_10202462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
3300031716|Ga0310813_11284223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
3300031719|Ga0306917_10474923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 981 | Open in IMG/M |
3300031781|Ga0318547_10112996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
3300031781|Ga0318547_10417956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 824 | Open in IMG/M |
3300031793|Ga0318548_10567294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300031797|Ga0318550_10461527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300031805|Ga0318497_10560802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300031821|Ga0318567_10431593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 747 | Open in IMG/M |
3300031833|Ga0310917_10846016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300031860|Ga0318495_10217995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
3300031941|Ga0310912_10682951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
3300032009|Ga0318563_10371253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
3300032010|Ga0318569_10376022 | Not Available | 662 | Open in IMG/M |
3300032010|Ga0318569_10378284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300032054|Ga0318570_10558212 | Not Available | 522 | Open in IMG/M |
3300032068|Ga0318553_10160277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1166 | Open in IMG/M |
3300032076|Ga0306924_11012788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 911 | Open in IMG/M |
3300032089|Ga0318525_10090227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1555 | Open in IMG/M |
3300032090|Ga0318518_10634092 | Not Available | 544 | Open in IMG/M |
3300032160|Ga0311301_10576022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1634 | Open in IMG/M |
3300032174|Ga0307470_11539232 | Not Available | 554 | Open in IMG/M |
3300032205|Ga0307472_102745576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300032892|Ga0335081_10035455 | All Organisms → cellular organisms → Bacteria | 7976 | Open in IMG/M |
3300032892|Ga0335081_11621866 | Not Available | 709 | Open in IMG/M |
3300032895|Ga0335074_11166130 | Not Available | 654 | Open in IMG/M |
3300032896|Ga0335075_11621276 | Not Available | 531 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.00% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068860_1015140552 | 3300005843 | Switchgrass Rhizosphere | GLEEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0070717_104576663 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGEDLFTERVAARVARMLCADNAKRAYQLGCEM* |
Ga0070717_107644211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLGEDLFTERVAARVARMLCADNAKRAYQLGCEM* |
Ga0075030_1013152991 | 3300006162 | Watersheds | GLDEDLYSERTVVRMSRMFCADNAKRAYQLGRQMLLVS* |
Ga0070715_100163671 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SAFLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0070716_1004389881 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0070712_1000134171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SAFLRSGLEEDLFTERAVVRVARMLSADNAKRAYRLGDQM* |
Ga0079222_104721443 | 3300006755 | Agricultural Soil | SAFLRTGLEEDLYTERTAARLARMLCADNAKRAYRLGDQISW* |
Ga0079220_104541172 | 3300006806 | Agricultural Soil | SGFLRAGLEEDLCTERVAARVARMLCADNAKRAYRLGSEM* |
Ga0074063_140205431 | 3300006953 | Soil | GLEEDLYTERTAARLAQMLCADNARRAYRLGDQM* |
Ga0105243_101158174 | 3300009148 | Miscanthus Rhizosphere | LRSGLEEDLYTERTAARLARMLCANNAKRAYRLGNQM* |
Ga0075423_113380573 | 3300009162 | Populus Rhizosphere | RSGLEDDLYTEGTAARLARMLCADNAKRAYRLGDQM* |
Ga0105237_126216931 | 3300009545 | Corn Rhizosphere | SGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0126380_121254912 | 3300010043 | Tropical Forest Soil | SGLEEDLFTEPTAARLARMICAGNARRAYRLGDQM* |
Ga0134125_104635731 | 3300010371 | Terrestrial Soil | RSALSAFLRSGLEEDIYTERTAARLARMLGADNAKRAYRLGDQM* |
Ga0136449_1014563731 | 3300010379 | Peatlands Soil | LSAFFASGLDEDLYTERTVLRLTKMICADNAKRAYALGDQM* |
Ga0136449_1042427562 | 3300010379 | Peatlands Soil | AFFTAGLNEDLYTERTVLRLTKMICADNAKRAYALGDQM* |
Ga0134127_128316052 | 3300010399 | Terrestrial Soil | SAFLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM* |
Ga0134123_100768511 | 3300010403 | Terrestrial Soil | SAFLRSGLDEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0126344_13773851 | 3300010866 | Boreal Forest Soil | FHTAGPEEDHFSGRTVVRLTRMLCADNAKRAYQLAN* |
Ga0126350_117058435 | 3300010880 | Boreal Forest Soil | AGVQEDHFSERTVVRLTRMLCADNAKRVYQLASQM* |
Ga0137382_102967842 | 3300012200 | Vadose Zone Soil | AFLRSGLEEDLFTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0137370_104466311 | 3300012285 | Vadose Zone Soil | LRSGLEEDLFTERTAARLARMLCADNAKRAYQLGDQM* |
Ga0137386_103201811 | 3300012351 | Vadose Zone Soil | SGLEEDLFTERTAARLARMLCADNATRAYRLGNQM* |
Ga0137371_100154277 | 3300012356 | Vadose Zone Soil | LSAFLRSGLEEDLFTERTAARLARMLGADNAKRAYQLGDQM* |
Ga0137385_102471404 | 3300012359 | Vadose Zone Soil | GLDDDLYTERAAIRLTKMICADNAKRAYQLGGQM* |
Ga0137416_119192731 | 3300012927 | Vadose Zone Soil | RSALSAFLRSGLEEDIYTERTAARLARMLGADNAKRAYQLGDQM* |
Ga0164299_100903683 | 3300012958 | Soil | RSGLEEDLYTERTAARLARMLCADNAKRAYRLGDHM* |
Ga0157373_109421363 | 3300013100 | Corn Rhizosphere | RSALSAFLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM* |
Ga0157371_109175831 | 3300013102 | Corn Rhizosphere | SCLRSGLEEDLYTERTAARLARRLCADNAKRAYRLGDQM* |
Ga0157372_106949581 | 3300013307 | Corn Rhizosphere | RSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM* |
Ga0163163_103475393 | 3300014325 | Switchgrass Rhizosphere | FLRSGLEEDLYTEPTAARLARMLCADNAKRAYRLGDHM* |
Ga0182041_123375812 | 3300016294 | Soil | AAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGDQM |
Ga0182033_107481121 | 3300016319 | Soil | LSEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0187812_10536421 | 3300017821 | Freshwater Sediment | LSDFLSAGLQEDLYTERTVVRLTRMLCADNAKRAYRLGDQM |
Ga0187802_101105212 | 3300017822 | Freshwater Sediment | TALSGFLAAGLQEDLFTERTVVRLTRMLCADNAKRAYGLGDQM |
Ga0187807_12781922 | 3300017926 | Freshwater Sediment | VLGGFLAAGLQEDLYTERTVARLTRMLCAENARRACRLGDQM |
Ga0187847_102147313 | 3300017948 | Peatland | LSDFLRAGIEEDLYSERTVARLTRMLCADNAKRAYQLADQM |
Ga0187816_100512091 | 3300017995 | Freshwater Sediment | ALSALFAAGLDEDLYTERTMLRLTKMICADNAKRAYALGDQM |
Ga0187871_107459702 | 3300018042 | Peatland | AGLSGDLYSERTVVRLARMLCADNAKRAYGLGDRM |
Ga0066662_129214061 | 3300018468 | Grasslands Soil | EFLRTSLEEDLFTERAAARVARMLSSDNAKHAYQLGREM |
Ga0173481_105010542 | 3300019356 | Soil | SALSAYLRTGLDQDIFTERTVVRVARMLSADNAKRAYQLGDQM |
Ga0210399_106962941 | 3300020581 | Soil | AGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0210405_100491591 | 3300021171 | Soil | LFRTALSAFLEAGVQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM |
Ga0210388_111564851 | 3300021181 | Soil | LRTGLDEGFYPERAVARLTRMICADNAKRAYRLGDKM |
Ga0210388_112169842 | 3300021181 | Soil | RTALSGFLTAGLQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM |
Ga0213881_101500702 | 3300021374 | Exposed Rock | SALSEFRRAGLEQDLYTERAAIRLTRMLGADNAKRAYQLGSQM |
Ga0213881_101853342 | 3300021374 | Exposed Rock | AALFRSALSEFLRAGLEQDLYTERVAARLTRMLGADNAKRAYQLGSQM |
Ga0210393_103935903 | 3300021401 | Soil | FLRNGLAEDLYTERTTVRLTRMICADNAKRAYQLGSQM |
Ga0210393_105921663 | 3300021401 | Soil | FLPAGLQEDHFSDRTVVRLTRMLCADNAKRAYQLANQM |
Ga0224541_10152541 | 3300022521 | Soil | FRTALSGLLTAGLEEDHYSERTVVRLTRMLCADNAKRAYRLANQM |
Ga0242672_11119732 | 3300022720 | Soil | ALFRSALSAFLRSGLEEELFTERTAARLARMLGADNAKRAYQLGDQM |
Ga0207700_119089751 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SALSGFLRSGLEEDLFTERVAARVARMLCADNAKRAYQLGCEM |
Ga0207664_119620852 | 3300025929 | Agricultural Soil | FLRAGLGEDLFTERVAARVTRMLCADNAKRAYQLGCEM |
Ga0208240_10434392 | 3300027030 | Forest Soil | LSAFLTAGLQEDHFSERTVVRLTRMLCADNAKRAYQLGDQM |
Ga0209166_103221852 | 3300027857 | Surface Soil | VLFRTALSGFLTAGVQEDHFSERTVVRLTRMLCADNAKRAYRLATQM |
Ga0209579_107817451 | 3300027869 | Surface Soil | SAFFTAGLNEDLYPERTVVRLTKMICADNAKRAYALGDQM |
Ga0302219_101463552 | 3300028747 | Palsa | RRALSGFLRAGLEEDLYSERTVARLTRMLCADNAKRAYQLANQM |
Ga0302224_102226931 | 3300028759 | Palsa | GFLRSGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM |
Ga0302231_102407681 | 3300028775 | Palsa | FLRSGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM |
Ga0302232_104214401 | 3300028789 | Palsa | FLHAGLDDDLYTERTAVRLARMLCADNAKRVYQLGERM |
Ga0302232_105161591 | 3300028789 | Palsa | LAEFLHAGLDDDLYTERTAVRLARMLCADNAKRVYRLEEQL |
Ga0307286_102825982 | 3300028876 | Soil | LRTGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM |
Ga0302235_102967942 | 3300028877 | Palsa | RALSDFLRAGIEEDLYSERTVVRLTRMLCADNAKRAYQLGGPFL |
Ga0311338_108892842 | 3300030007 | Palsa | SDFLRTGLEEDLYSERTVVRLTRMLCADNAKRAYQLADQM |
Ga0302178_100615811 | 3300030013 | Palsa | MLFRTALSGLLTAGLEDDHYSERTVVRLTRMLCADNAKRAYQLANQM |
Ga0302306_102787171 | 3300030043 | Palsa | SGLEEDLYSERTVVRLTRMLCADNAKRAYRLGDQM |
Ga0311372_105453861 | 3300030520 | Palsa | AGIEEDLYSERTVVRLTRMLCADNAKRAYQLGGPFL |
Ga0311372_109996023 | 3300030520 | Palsa | SAHLSAGRAEDLYPERAVVRLTRMLCADNARRVYALGEQM |
Ga0265461_115591742 | 3300030743 | Soil | SDFLRTGMNEGFYPERAVARLTRMICADNAKRAYRLGDKM |
Ga0307500_102392491 | 3300031198 | Soil | RSALSAFLRSGLEEDLYTERTAARLARMLCADNAKRAYRLGDQM |
Ga0302307_101358613 | 3300031233 | Palsa | LAAALFRTALSGLLTAGLEEDHYSERTVVRLTRMLCADNAKRAYRLANQM |
Ga0318538_106923882 | 3300031546 | Soil | ALSEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0318561_102024621 | 3300031679 | Soil | SEFLSAGLDEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0310813_112842232 | 3300031716 | Soil | FLQTGLEQDLYTERTAARLARMLCADNAKRAYRLGDQM |
Ga0306917_104749231 | 3300031719 | Soil | RSGLDEDLFTEPTAARLARMICAGNAKRAYRLGDRM |
Ga0318547_101129961 | 3300031781 | Soil | FRLALSVFLRSGLEEDLFTERTAARLARMLCADNAKRAYQLGDQM |
Ga0318547_104179562 | 3300031781 | Soil | FNAGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0318548_105672942 | 3300031793 | Soil | FLRSGLEEDLYTERTAARLARMLCADNARRAYQLGDQL |
Ga0318550_104615271 | 3300031797 | Soil | VGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0318497_105608022 | 3300031805 | Soil | RRALSEFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM |
Ga0318567_104315932 | 3300031821 | Soil | EFLSAGLDEDLYSERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0310917_108460161 | 3300031833 | Soil | ALSDFLAAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGEQM |
Ga0318495_102179951 | 3300031860 | Soil | LFSGLEQNLYTERTAARLARMLCADNAKRAYGLGDQM |
Ga0310912_106829511 | 3300031941 | Soil | RSGLEEDLFTEGTAARLARMLGADNAKRAYQLGDQM |
Ga0318563_103712531 | 3300032009 | Soil | SDFLAAGVAEDLYPERTVVRLTRMLCADNAKRAYGLGDQM |
Ga0318569_103760222 | 3300032010 | Soil | LAAGLQDDLYSERTVVRLARMLCADNAKRAYGLADQM |
Ga0318569_103782841 | 3300032010 | Soil | SEFFNAGLGEGLYTERTVVRLTRMLGADNAKRAYGLGDQM |
Ga0318570_105582121 | 3300032054 | Soil | DFLAAGLAEDLYSERTVVRLTRMLCADNAKRAYGLGDQM |
Ga0318553_101602771 | 3300032068 | Soil | EFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM |
Ga0306924_110127881 | 3300032076 | Soil | LFRSALSAFLRSGLEEDLFTEATAARLARMLGADNAKRAYQLGDQM |
Ga0318525_100902271 | 3300032089 | Soil | TAGLDEDLYSERTVVRLTRMLCADNAKRAYGLGDQM |
Ga0318518_106340922 | 3300032090 | Soil | RALSEFFNAGLGEGLYTERTVVRLTRMLCADNAKRAYGLGEQM |
Ga0311301_105760223 | 3300032160 | Peatlands Soil | LSGFLTAGLQEDLFTERTVVRLTRMLCADNAKRAYRLGDQM |
Ga0307470_115392322 | 3300032174 | Hardwood Forest Soil | SALFRSALSAFLRSGLEDKLFTERAVVRVARMLSAENAKRAYQLGDQM |
Ga0307472_1027455762 | 3300032205 | Hardwood Forest Soil | FLRSGLEEDLFTERTAARLARMLGAENAKRAYQLGDQM |
Ga0335081_1003545511 | 3300032892 | Soil | SAFLRSGLSEDLFTERTAVRLTRMFCADNAKRAYQLGSQM |
Ga0335081_116218661 | 3300032892 | Soil | FLRSGLSEDLYTERTAIRLTRMFCADNAKRAYQLGSQM |
Ga0335074_111661301 | 3300032895 | Soil | SGLFAAGLDEDLYTERTVLRLTKMICADNAKRAYALGDQM |
Ga0335075_116212762 | 3300032896 | Soil | GLPEPYFLGAALFRTALSVLFTEGLNEDLYAERTVLRLTKMICADNAKRAYALGDQM |
⦗Top⦘ |