Basic Information | |
---|---|
Family ID | F105843 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 38 residues |
Representative Sequence | SPESPVMLVLDPAFLIALAAVISSLSAFVWAVRRKP |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 35.00 % |
% of genes near scaffold ends (potentially truncated) | 61.00 % |
% of genes from short scaffolds (< 2000 bps) | 85.00 % |
Associated GOLD sequencing projects | 67 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (16.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (71.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (76.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00563 | EAL | 13.00 |
PF00188 | CAP | 10.00 |
PF00583 | Acetyltransf_1 | 5.00 |
PF03602 | Cons_hypoth95 | 5.00 |
PF02224 | Cytidylate_kin | 4.00 |
PF13505 | OMP_b-brl | 4.00 |
PF00575 | S1 | 4.00 |
PF02397 | Bac_transf | 3.00 |
PF03734 | YkuD | 2.00 |
PF03976 | PPK2 | 1.00 |
PF04055 | Radical_SAM | 1.00 |
PF00353 | HemolysinCabind | 1.00 |
PF07411 | DUF1508 | 1.00 |
PF08818 | DUF1801 | 1.00 |
PF00990 | GGDEF | 1.00 |
PF12697 | Abhydrolase_6 | 1.00 |
PF07690 | MFS_1 | 1.00 |
PF16930 | Porin_5 | 1.00 |
PF04402 | SIMPL | 1.00 |
PF00132 | Hexapep | 1.00 |
PF00849 | PseudoU_synth_2 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 13.00 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 13.00 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 13.00 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 13.00 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 10.00 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 5.00 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 5.00 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 5.00 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 5.00 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 5.00 |
COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 4.00 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 3.00 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.00 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 1.00 |
COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 1.00 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 1.00 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.00 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.00 % |
Unclassified | root | N/A | 13.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001305|C688J14111_10123732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 791 | Open in IMG/M |
3300002886|JGI25612J43240_1002517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2340 | Open in IMG/M |
3300004081|Ga0063454_100493291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 858 | Open in IMG/M |
3300005327|Ga0070658_10026100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 4686 | Open in IMG/M |
3300005327|Ga0070658_10815132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 811 | Open in IMG/M |
3300005331|Ga0070670_100047599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3690 | Open in IMG/M |
3300005333|Ga0070677_10152785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1076 | Open in IMG/M |
3300005335|Ga0070666_10608164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 798 | Open in IMG/M |
3300005344|Ga0070661_100184859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1587 | Open in IMG/M |
3300005344|Ga0070661_100420938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1059 | Open in IMG/M |
3300005353|Ga0070669_100410149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
3300005353|Ga0070669_101779723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 537 | Open in IMG/M |
3300005354|Ga0070675_100193508 | Not Available | 1763 | Open in IMG/M |
3300005364|Ga0070673_102343162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 507 | Open in IMG/M |
3300005366|Ga0070659_100661071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 901 | Open in IMG/M |
3300005435|Ga0070714_100564686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1090 | Open in IMG/M |
3300005455|Ga0070663_100841464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 789 | Open in IMG/M |
3300005459|Ga0068867_101108365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 723 | Open in IMG/M |
3300005539|Ga0068853_101256094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 715 | Open in IMG/M |
3300005543|Ga0070672_100071410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2762 | Open in IMG/M |
3300005543|Ga0070672_100123339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2123 | Open in IMG/M |
3300005543|Ga0070672_100622546 | Not Available | 941 | Open in IMG/M |
3300005543|Ga0070672_100813831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 822 | Open in IMG/M |
3300005548|Ga0070665_100004175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 15195 | Open in IMG/M |
3300005548|Ga0070665_100558375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1157 | Open in IMG/M |
3300005563|Ga0068855_100124432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2950 | Open in IMG/M |
3300005563|Ga0068855_100440460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1423 | Open in IMG/M |
3300005564|Ga0070664_100077460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2858 | Open in IMG/M |
3300005577|Ga0068857_100556078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1081 | Open in IMG/M |
3300005577|Ga0068857_101936734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 578 | Open in IMG/M |
3300005614|Ga0068856_100785371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 972 | Open in IMG/M |
3300005614|Ga0068856_102569431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 515 | Open in IMG/M |
3300005718|Ga0068866_10156912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1323 | Open in IMG/M |
3300005718|Ga0068866_11311143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 526 | Open in IMG/M |
3300006169|Ga0082029_1303005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 520 | Open in IMG/M |
3300006581|Ga0074048_10035708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1517 | Open in IMG/M |
3300006854|Ga0075425_102917686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 524 | Open in IMG/M |
3300009094|Ga0111539_11729237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 725 | Open in IMG/M |
3300009100|Ga0075418_11472668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 739 | Open in IMG/M |
3300009177|Ga0105248_13058395 | Not Available | 533 | Open in IMG/M |
3300009551|Ga0105238_12865829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 518 | Open in IMG/M |
3300010375|Ga0105239_13266676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
3300010396|Ga0134126_12284727 | Not Available | 589 | Open in IMG/M |
3300012955|Ga0164298_10303604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 990 | Open in IMG/M |
3300012958|Ga0164299_10638588 | Not Available | 734 | Open in IMG/M |
3300012958|Ga0164299_11529407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
3300012961|Ga0164302_11562176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 547 | Open in IMG/M |
3300012989|Ga0164305_11178063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 663 | Open in IMG/M |
3300013100|Ga0157373_10603629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 799 | Open in IMG/M |
3300013100|Ga0157373_10759919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 713 | Open in IMG/M |
3300013100|Ga0157373_10761113 | Not Available | 712 | Open in IMG/M |
3300013102|Ga0157371_11166405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300013105|Ga0157369_12411331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 533 | Open in IMG/M |
3300014497|Ga0182008_10137411 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300014968|Ga0157379_10413171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1242 | Open in IMG/M |
3300014968|Ga0157379_12126665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 557 | Open in IMG/M |
3300015371|Ga0132258_10551835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2888 | Open in IMG/M |
3300015374|Ga0132255_106156162 | Not Available | 508 | Open in IMG/M |
3300018476|Ga0190274_13205711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 550 | Open in IMG/M |
3300018920|Ga0190273_10442521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 930 | Open in IMG/M |
3300020070|Ga0206356_11210237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 977 | Open in IMG/M |
3300021363|Ga0193699_10277277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 699 | Open in IMG/M |
3300021388|Ga0213875_10003720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 8590 | Open in IMG/M |
3300025893|Ga0207682_10042336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1861 | Open in IMG/M |
3300025901|Ga0207688_10131084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1469 | Open in IMG/M |
3300025903|Ga0207680_10349660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1038 | Open in IMG/M |
3300025903|Ga0207680_10567681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 811 | Open in IMG/M |
3300025909|Ga0207705_10375967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1097 | Open in IMG/M |
3300025909|Ga0207705_11363123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
3300025912|Ga0207707_11449789 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300025919|Ga0207657_10113866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2231 | Open in IMG/M |
3300025919|Ga0207657_10829080 | Not Available | 714 | Open in IMG/M |
3300025919|Ga0207657_11202752 | Not Available | 576 | Open in IMG/M |
3300025920|Ga0207649_11580519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 519 | Open in IMG/M |
3300025923|Ga0207681_11701448 | Not Available | 527 | Open in IMG/M |
3300025924|Ga0207694_11410943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
3300025930|Ga0207701_10175169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1894 | Open in IMG/M |
3300025932|Ga0207690_10130460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1839 | Open in IMG/M |
3300025932|Ga0207690_10188279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1559 | Open in IMG/M |
3300025935|Ga0207709_10635184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 849 | Open in IMG/M |
3300025938|Ga0207704_11028905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 698 | Open in IMG/M |
3300025945|Ga0207679_10115915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2123 | Open in IMG/M |
3300025949|Ga0207667_10817875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 927 | Open in IMG/M |
3300025949|Ga0207667_10850036 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300026088|Ga0207641_10550616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1125 | Open in IMG/M |
3300026121|Ga0207683_10141867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2165 | Open in IMG/M |
3300026285|Ga0209438_1000008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 71157 | Open in IMG/M |
3300026312|Ga0209153_1126016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 969 | Open in IMG/M |
3300027288|Ga0208525_1032770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 633 | Open in IMG/M |
3300027750|Ga0209461_10083484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 701 | Open in IMG/M |
3300027766|Ga0209796_10172304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 682 | Open in IMG/M |
3300028379|Ga0268266_10012945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 7194 | Open in IMG/M |
3300028380|Ga0268265_10389426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1285 | Open in IMG/M |
3300028381|Ga0268264_11831086 | Not Available | 617 | Open in IMG/M |
3300028889|Ga0247827_10777455 | Not Available | 632 | Open in IMG/M |
3300031547|Ga0310887_11072094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 516 | Open in IMG/M |
3300031548|Ga0307408_101270502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 689 | Open in IMG/M |
3300031995|Ga0307409_101398205 | Not Available | 726 | Open in IMG/M |
3300032005|Ga0307411_10374402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1169 | Open in IMG/M |
3300033551|Ga0247830_10233791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1385 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 16.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 11.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.00% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J14111_101237322 | 3300001305 | Soil | MSEWVAVVLILDPALMIALAALISSLSALIWAVRRKP* |
JGI25612J43240_10025173 | 3300002886 | Grasslands Soil | VAAFRSESLVMLVLDPSMMIAFAALISSLSAFVWAVRRKP* |
Ga0063454_1004932912 | 3300004081 | Soil | NKRLVESPVMLVLDPALLIALAALVSSLSAFIWAVRRKP* |
Ga0070658_100261002 | 3300005327 | Corn Rhizosphere | MVNIGLWSRLMVVLDPPLLIAIAALISSLSAFIWAVRRKP* |
Ga0070658_108151322 | 3300005327 | Corn Rhizosphere | MELRLSSESPVMLVLDPALLIAVAAVISSLSAFVWAVRRKP* |
Ga0070670_1000475991 | 3300005331 | Switchgrass Rhizosphere | HIGNMLIRESRSMVILDAPMLVAIAALISSISAFVWAVRRKP* |
Ga0070677_101527851 | 3300005333 | Miscanthus Rhizosphere | EQRAMESPVIMVLNPAMLIALAALISSLSAFVWAVRRKP* |
Ga0070666_106081641 | 3300005335 | Switchgrass Rhizosphere | MNMLSLESHLMIVLDPAVLIAIAALISSLSALVWAVRRKP* |
Ga0070661_1001848594 | 3300005344 | Corn Rhizosphere | MVNIGLWSRLMVVLDPPLLIAIAALISSLSAFIWAVRKAVIR* |
Ga0070661_1004209381 | 3300005344 | Corn Rhizosphere | RMRNMRLRSRFMLIIDPAMLIGLAAIISSLSALVWAVRRKP* |
Ga0070669_1004101491 | 3300005353 | Switchgrass Rhizosphere | DREQGLARSRFMLVLDPPMVVALAAVISSLSAFIWAVRRKP* |
Ga0070669_1017797232 | 3300005353 | Switchgrass Rhizosphere | RGSFCPESPAMLVLDPALLIALAALISSLSAFVWAVRRKP* |
Ga0070675_1001935081 | 3300005354 | Miscanthus Rhizosphere | NREQNLCALAGVALMLILDPALMIGLAALISSVSALVWAMRRKP* |
Ga0070673_1023431621 | 3300005364 | Switchgrass Rhizosphere | SEQESVESRLMLVLDPALLIALAALISSLSAFVWAVRRKP* |
Ga0070659_1006610712 | 3300005366 | Corn Rhizosphere | MNVRNIRSRVVMLYLDPPIVIALATLISSLSALVWAFRRKP* |
Ga0070714_1005646863 | 3300005435 | Agricultural Soil | MRNMRLRSRFMLIIDPAMLIGLAAIISSLSALVWAVRRKP* |
Ga0070663_1008414641 | 3300005455 | Corn Rhizosphere | MLIRESRSMVILDAPMLVAIAALISSISAFVWAVRRALDPPR |
Ga0068867_1011083651 | 3300005459 | Miscanthus Rhizosphere | ETDREQRAMESPVIMVLNPAMLIALAALISSLSAFVWAVRRKP* |
Ga0068853_1012560941 | 3300005539 | Corn Rhizosphere | EHRGSFCPESPAMLVLDPALLIALAALISSLSAFVWAVRRKP* |
Ga0070672_1000714104 | 3300005543 | Miscanthus Rhizosphere | MESRLMLVLDPALLIALAAVISSLSAFIWAVRRKP* |
Ga0070672_1001233392 | 3300005543 | Miscanthus Rhizosphere | MESPVIMVLNPAMLIALAALISSLSAFVWAVRRKP* |
Ga0070672_1006225464 | 3300005543 | Miscanthus Rhizosphere | LARSRFMLVLDPPMVVALAAVISSLSAFIWAVRRKP* |
Ga0070672_1008138312 | 3300005543 | Miscanthus Rhizosphere | RLDGVVVMLILDPAFLIALAALISSLSAFVWSVRRKP* |
Ga0070665_10000417516 | 3300005548 | Switchgrass Rhizosphere | MLLFSSESVVMLVLDPPLLIAVAAVISSLSAFIWAVRRKP* |
Ga0070665_1005583752 | 3300005548 | Switchgrass Rhizosphere | MLIRESRSMVILDAPMLVAIAALISSISAFVWAVRRKP* |
Ga0068855_1001244323 | 3300005563 | Corn Rhizosphere | MESRLMLVLDPPFLIAIAALISSISAFIWAVRRKP* |
Ga0068855_1004404603 | 3300005563 | Corn Rhizosphere | LESRVMLVVNPEFLIALAALISSLSAFVWAVRRKP* |
Ga0070664_1000774601 | 3300005564 | Corn Rhizosphere | GQLGVAAMLVLDPAFLIALAALVSSLSAFVWSVRRKP* |
Ga0068857_1005560782 | 3300005577 | Corn Rhizosphere | MESCLMLFLDPPFLIAIAALISSISAFIWAVRRKP* |
Ga0068857_1019367341 | 3300005577 | Corn Rhizosphere | TAGVAAMLVLDPSFLIALAALISSLSAFVWAVRRKP* |
Ga0068856_1007853712 | 3300005614 | Corn Rhizosphere | MESRLMLFLDPPFLIAIAALISSISAFIWAVRRKP* |
Ga0068856_1025694312 | 3300005614 | Corn Rhizosphere | RSRDVMLVLDPSMLIAVAALISSLSALVWAVRRKP* |
Ga0068866_101569121 | 3300005718 | Miscanthus Rhizosphere | MGGVGVRSRVMLVLDPSMLIAVAALISSLSAFVWAVRRKP* |
Ga0068866_113111431 | 3300005718 | Miscanthus Rhizosphere | LARMESPLMLVIDPALLIALAAVISSLSAFIWSLRRKP* |
Ga0082029_13030052 | 3300006169 | Termite Nest | ESRVMLVVDPAFLIALAAVISSLSAFVWSVRRKP* |
Ga0074048_100357081 | 3300006581 | Soil | SGPAFRSESLVMLVLDPSMLIAVAAVISSLSAFVWAVRRKP* |
Ga0075425_1029176862 | 3300006854 | Populus Rhizosphere | REHRDMESPLMLVLDPAVLIALAAVISSLSTFIWSVRRKP* |
Ga0111539_117292373 | 3300009094 | Populus Rhizosphere | WAVRIHSESPVMLVIDPPVLIALATLISSLSALVWAFRRKP* |
Ga0075418_114726683 | 3300009100 | Populus Rhizosphere | SSESPVMLVIDPPVLIALATLISSLSALVWAFRRKP* |
Ga0105248_130583951 | 3300009177 | Switchgrass Rhizosphere | HGGARSRVAMLVLDPSMLIAVAAVITSFSALVWAVRRKP* |
Ga0105238_128658292 | 3300009551 | Corn Rhizosphere | SPESPVMLVLDPAFLIALAAVISSLSAFVWAVRRKP* |
Ga0105239_132666761 | 3300010375 | Corn Rhizosphere | LGVVQMLVLDPSFLLGLAAVISSVSALVWAVRRKP* |
Ga0134126_122847272 | 3300010396 | Terrestrial Soil | MSVWSRAMLILDPAMLIALAALVSSLSAFVWAVRRKP* |
Ga0164298_103036042 | 3300012955 | Soil | ERVESHRMLVLDPAFLIALAALVSSLSAFVWAVRRKP* |
Ga0164299_106385882 | 3300012958 | Soil | MVNIDRWSRLMVVLDPPLLIALAALISSLSAFIWAV |
Ga0164299_115294072 | 3300012958 | Soil | REQRAPESLVMLVLDPAFLIALAALVSSLSAFVWAVRRKP* |
Ga0164302_115621762 | 3300012961 | Soil | MESPVMLVLNPAMLIALAALISSLSAFIWAVRRKP* |
Ga0164305_111780632 | 3300012989 | Soil | MVNIDRWSRLMVVLDPPLLIALAALISSLSAFIWAVRRKP* |
Ga0157373_106036291 | 3300013100 | Corn Rhizosphere | RSRFMLIIDPAMLIALAAIISSLSALVWAVRRKP* |
Ga0157373_107599192 | 3300013100 | Corn Rhizosphere | LWSRAVMLVLDPALLIALAALISSLSAFVWSVRRKP* |
Ga0157373_107611131 | 3300013100 | Corn Rhizosphere | MKAAFRSESRVMLVLNPEMMIALAALISSVSAFVWAVRRKP* |
Ga0157371_111664051 | 3300013102 | Corn Rhizosphere | ERLGVVQMLVLDPSFLGGRAAVINRVSALVWAVRRKP* |
Ga0157369_124113311 | 3300013105 | Corn Rhizosphere | RRSRFMLIIDPAMLIALAAIISSLSALVSAVRRKP* |
Ga0182008_101374112 | 3300014497 | Rhizosphere | MVNICVWSRLMLVLDPPLLLAIAALISSLSAFIWAVRRKP* |
Ga0157379_104131714 | 3300014968 | Switchgrass Rhizosphere | VRNIRSRVVMLYLDPPIVIALATLISSLSALVWAFRRKP* |
Ga0157379_121266652 | 3300014968 | Switchgrass Rhizosphere | MESHLMLVLDPPFLIAIAALISSISAFIWAVRRKP* |
Ga0132258_105518353 | 3300015371 | Arabidopsis Rhizosphere | MESRMLVLDPALLMALAALISSLSAFVWALRRKP* |
Ga0132255_1061561621 | 3300015374 | Arabidopsis Rhizosphere | LRSESLMLVLDPPMIVAVAAVISSLSAFIWAVRRRP* |
Ga0190274_132057113 | 3300018476 | Soil | LRRLIVLVLDPAALFAIAALISSVSALVWAVRRKP |
Ga0190273_104425211 | 3300018920 | Soil | TLGVAPMLVLDPPALLGLAAFITSLSALVWAVRRKP |
Ga0206356_112102371 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | CGSGVAPMVVVDPSLLIAIAALISSLSAFIWAIRRKP |
Ga0193699_102772771 | 3300021363 | Soil | CGTESPLMLLLDPAMLIALAALISSLSAFVWAVRRKP |
Ga0213875_100037204 | 3300021388 | Plant Roots | MAAIRPESHPMVLIDPALLIALAALISSLSAFVWAVRRKP |
Ga0207682_100423362 | 3300025893 | Miscanthus Rhizosphere | MESRLMLVLDPPFLIAIAALISSISAFIWAVRRKP |
Ga0207688_101310841 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIRESRSMVILDAPMLVAIAALISSISAFVWAVRRKP |
Ga0207680_103496603 | 3300025903 | Switchgrass Rhizosphere | DGAPESLVMLVLDPSMVIAVAALITSLSALIWAVRRKP |
Ga0207680_105676812 | 3300025903 | Switchgrass Rhizosphere | MNMLSLESHLMIVLDPAVLIAIAALISSLSALVWAVRRKP |
Ga0207705_103759672 | 3300025909 | Corn Rhizosphere | LGVVQMLVLDPSFLLGLAAVISSVSALVWAVRRKP |
Ga0207705_113631231 | 3300025909 | Corn Rhizosphere | ALESLPMLVLDPALLIAVAALISSLSAFVWAVRRKP |
Ga0207707_114497891 | 3300025912 | Corn Rhizosphere | RSRSESLVMLVFTPAMLIAVAALISSLSAFVWSVRRKP |
Ga0207657_101138663 | 3300025919 | Corn Rhizosphere | MRMESRLMLVIDPAMLIAVAAVISSLSAFVWAVRRKP |
Ga0207657_108290801 | 3300025919 | Corn Rhizosphere | HAHQESRSMVILDAPMLVAIAALISSISAFVWAVRRKP |
Ga0207657_112027523 | 3300025919 | Corn Rhizosphere | EQYDSLESREMLVVDPLMLMAVAALISSLSTFVWAVRRKP |
Ga0207649_115805192 | 3300025920 | Corn Rhizosphere | MRNMRLRSRFMLIIDPAMLIGLAAIISSLSALVWAVRRKP |
Ga0207681_117014481 | 3300025923 | Switchgrass Rhizosphere | TKWLLSESLMLVLDPPMIVAVAAVVSSFSALVWALRRKP |
Ga0207694_114109431 | 3300025924 | Corn Rhizosphere | SPESPVMLVLDPAFLIALAAVISSLSAFVWAVRRKP |
Ga0207701_101751692 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MESPVIMVLNPAMLIALAALISSLSAFVWAVRRKP |
Ga0207690_101304601 | 3300025932 | Corn Rhizosphere | ETNREHGGAWSRVAMLVLDPSMLIAVAAVITSFSALVWAVRRKP |
Ga0207690_101882792 | 3300025932 | Corn Rhizosphere | GMESRLMLVIDPAMLIAVAAVISSLSAFVWAVRRKP |
Ga0207709_106351842 | 3300025935 | Miscanthus Rhizosphere | GNKSASESLMLVLDPPALVGLAAFITSLSALVWALRRKP |
Ga0207704_110289051 | 3300025938 | Miscanthus Rhizosphere | SMESRLMLVLDPALLIALAAVISSLSAFIWAVRRKP |
Ga0207679_101159151 | 3300025945 | Corn Rhizosphere | MNMLSLESHLMIVLDPAVLIAIAALISSLSTLVWAVRRKP |
Ga0207667_108178751 | 3300025949 | Corn Rhizosphere | WAVRIHSESPVMLVIDPPVLIALATLISSLSALVWAFRRKP |
Ga0207667_108500363 | 3300025949 | Corn Rhizosphere | PLESRVMLVVNPEFLIALAALISSLSAFVWAVRRKP |
Ga0207641_105506162 | 3300026088 | Switchgrass Rhizosphere | MESRLMLFLDPPFLIAIAALISSISAFIWAVRRKP |
Ga0207683_101418672 | 3300026121 | Miscanthus Rhizosphere | MESPVIMVLNPAMLIALAALISSLSAFVWALRRKP |
Ga0209438_100000855 | 3300026285 | Grasslands Soil | VAAFRSESLVMLVLDPSMMIAFAALISSLSAFVWAVRRKP |
Ga0209153_11260161 | 3300026312 | Soil | VESPIVLVLDPSLLIALAALISSLSAFVWAVRRKP |
Ga0208525_10327702 | 3300027288 | Soil | SEHEGVESRLMLILDPPFLIALAALISSLSAFVWAVRRKR |
Ga0209461_100834841 | 3300027750 | Agave | MHGVAFMLVLDPALLIALAALISSLSAFVWAVRRKP |
Ga0209796_101723042 | 3300027766 | Agave | GMNREQEGCAFCSESRAMLVLDPAFMIALAALISSLSAFVWSVRRKP |
Ga0268266_100129452 | 3300028379 | Switchgrass Rhizosphere | MLLFSSESVVMLVLDPPLLIAVAAVISSLSAFIWAVRRKP |
Ga0268265_103894261 | 3300028380 | Switchgrass Rhizosphere | RSESPVMLVLDPSMLIAFAALISSLSAFVWAVRRKP |
Ga0268264_118310862 | 3300028381 | Switchgrass Rhizosphere | MELRLSSESLVMLVLDPPLLIAVAAVISSLSAFVWAVRRKP |
Ga0247827_107774551 | 3300028889 | Soil | LSWSRSMLVLDPQAMLGIAALITSLSTLVWALRRKP |
Ga0310887_110720941 | 3300031547 | Soil | IGNIAGLESLTMLVIDPAFLIAVAALISSVSAFVWAVRRKP |
Ga0307408_1012705022 | 3300031548 | Rhizosphere | MLRPRRLSVLVLDPALLIAFAALVSSLSAFVWAVRRRP |
Ga0307409_1013982051 | 3300031995 | Rhizosphere | SVGVAVMLVLDPAILISFAALISSLSAFVWAVRRKP |
Ga0307411_103744022 | 3300032005 | Rhizosphere | MGELGVAFMLVLDPPALLAIAAVISSLSALVWAVRRKP |
Ga0247830_102337913 | 3300033551 | Soil | LVRSESPMLVLDPPALFAVAAVITSLSALIWAVRRKP |
⦗Top⦘ |