NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105701

Metagenome Family F105701

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105701
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV
Number of Associated Samples 88
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 96.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(42.000 % of family members)
Environment Ontology (ENVO) Unclassified
(44.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.23%    β-sheet: 33.80%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF08352oligo_HPY 82.00
PF00296Bac_luciferase 11.00
PF00005ABC_tran 3.00
PF00528BPD_transp_1 2.00
PF00873ACR_tran 1.00
PF03551PadR 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 11.00
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.00
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.00
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.00 %
UnclassifiedrootN/A23.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100225927All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300005332|Ga0066388_103570228All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005332|Ga0066388_106480950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales590Open in IMG/M
3300005332|Ga0066388_108782383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300005439|Ga0070711_100279873All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300005468|Ga0070707_100565024All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300005535|Ga0070684_101840592All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005538|Ga0070731_10693053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba677Open in IMG/M
3300005553|Ga0066695_10607272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300005555|Ga0066692_10682503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales638Open in IMG/M
3300005557|Ga0066704_10943464All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005568|Ga0066703_10162027All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300005587|Ga0066654_10342503Not Available811Open in IMG/M
3300005764|Ga0066903_102510653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium998Open in IMG/M
3300005841|Ga0068863_102235107All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005921|Ga0070766_10646551All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300006173|Ga0070716_101438231All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006175|Ga0070712_100566500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium958Open in IMG/M
3300006796|Ga0066665_11261649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300006800|Ga0066660_11027553All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300007255|Ga0099791_10387973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300009012|Ga0066710_102457878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Dietziaceae → Dietzia → Dietzia alimentaria754Open in IMG/M
3300009089|Ga0099828_11107242All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300009137|Ga0066709_104683542All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010359|Ga0126376_10942294All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300010361|Ga0126378_10359693All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300010376|Ga0126381_104318937All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010376|Ga0126381_105085504Not Available504Open in IMG/M
3300010398|Ga0126383_10032836All Organisms → cellular organisms → Bacteria4140Open in IMG/M
3300010398|Ga0126383_12241726All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012200|Ga0137382_10869486All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300012202|Ga0137363_10819817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales789Open in IMG/M
3300012356|Ga0137371_11335806All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012361|Ga0137360_11381664All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012944|Ga0137410_10835219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria776Open in IMG/M
3300012971|Ga0126369_13442923Not Available518Open in IMG/M
3300013307|Ga0157372_13420739All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300014156|Ga0181518_10152550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1237Open in IMG/M
3300016319|Ga0182033_10375211Not Available1196Open in IMG/M
3300016371|Ga0182034_11262872Not Available643Open in IMG/M
3300016404|Ga0182037_10799605Not Available813Open in IMG/M
3300016404|Ga0182037_10849465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium789Open in IMG/M
3300016422|Ga0182039_11778160All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300020580|Ga0210403_10131026Not Available2044Open in IMG/M
3300020580|Ga0210403_10968442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300020580|Ga0210403_11392869All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300020581|Ga0210399_10782214Not Available780Open in IMG/M
3300020583|Ga0210401_10884100All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300021178|Ga0210408_10761136All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300021181|Ga0210388_10497004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1071Open in IMG/M
3300025928|Ga0207700_10806260Not Available840Open in IMG/M
3300026023|Ga0207677_11244586All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300026542|Ga0209805_1067137All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300026550|Ga0209474_10237057All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300027737|Ga0209038_10074965All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300027846|Ga0209180_10605607Not Available605Open in IMG/M
3300027862|Ga0209701_10556396Not Available615Open in IMG/M
3300028673|Ga0257175_1126097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300031543|Ga0318516_10280318All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300031543|Ga0318516_10537992All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031544|Ga0318534_10878330All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031564|Ga0318573_10144242All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300031640|Ga0318555_10411079Not Available733Open in IMG/M
3300031668|Ga0318542_10147510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1167Open in IMG/M
3300031668|Ga0318542_10455422Not Available663Open in IMG/M
3300031679|Ga0318561_10015240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum3459Open in IMG/M
3300031681|Ga0318572_10383145Not Available835Open in IMG/M
3300031682|Ga0318560_10304435All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300031724|Ga0318500_10329925Not Available751Open in IMG/M
3300031736|Ga0318501_10088146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum1529Open in IMG/M
3300031748|Ga0318492_10570980All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031753|Ga0307477_10934136Not Available571Open in IMG/M
3300031765|Ga0318554_10861259All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031778|Ga0318498_10213303All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300031781|Ga0318547_10068371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum1961Open in IMG/M
3300031781|Ga0318547_10218243All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300031792|Ga0318529_10608583Not Available507Open in IMG/M
3300031796|Ga0318576_10621067All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031799|Ga0318565_10191938Not Available993Open in IMG/M
3300031799|Ga0318565_10211401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium943Open in IMG/M
3300031819|Ga0318568_10157245All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300031821|Ga0318567_10151121All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300031832|Ga0318499_10124908All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300031833|Ga0310917_10254720All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300031879|Ga0306919_10839955Not Available705Open in IMG/M
3300031910|Ga0306923_11452161All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300031912|Ga0306921_12003430All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031941|Ga0310912_10698785Not Available786Open in IMG/M
3300031954|Ga0306926_11910057Not Available670Open in IMG/M
3300031981|Ga0318531_10025094All Organisms → cellular organisms → Bacteria2409Open in IMG/M
3300031981|Ga0318531_10276496Not Available758Open in IMG/M
3300032009|Ga0318563_10219996All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300032010|Ga0318569_10134300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1133Open in IMG/M
3300032041|Ga0318549_10195554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium907Open in IMG/M
3300032052|Ga0318506_10100240All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300032060|Ga0318505_10226478All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300032068|Ga0318553_10329775All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300032076|Ga0306924_11178019Not Available830Open in IMG/M
3300032174|Ga0307470_10491220All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300032205|Ga0307472_100547827All Organisms → cellular organisms → Bacteria1009Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil42.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10022592733300004152Bog Forest SoilMVPPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV
Ga0066388_10357022813300005332Tropical Forest SoilMPPLIEFVDVSKRFVGGLGREGTLALAGFSLAIDAERPSVIAVVGESGSGK
Ga0066388_10648095023300005332Tropical Forest SoilMAPLIEAVDVSKRFAGGLEREGTLALAGLSLAIDAEQPSIIAVVGESGSGK
Ga0066388_10878238323300005332Tropical Forest SoilVAPLIEAVGVSKRFPGWLGRESTLALAPLSFAIHSEQPAVTAVVGESGSGKT
Ga0070711_10027987333300005439Corn, Switchgrass And Miscanthus RhizosphereMVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIA
Ga0070707_10056502413300005468Corn, Switchgrass And Miscanthus RhizosphereMREMAPLIEAVDVTKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESG
Ga0070684_10184059213300005535Corn RhizosphereVRAMAPLIEAVDVSKRFAGGLGREGTLALASLSLTIDDARPSIIAVVG
Ga0070731_1069305323300005538Surface SoilMSALIEAVDVSKRFAGRFGREATLALAPVSLTIEAGTPRILAVVGESGSGK
Ga0066695_1060727213300005553SoilMAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESG
Ga0066692_1068250313300005555SoilMAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESGSGK
Ga0066704_1094346413300005557SoilMMPISHDAMPPLIEAVEVGKRFGGGLGREGTLALAGLSLA
Ga0066703_1016202723300005568SoilMAPLIEAVDVSKRFAGGLGREATLALAGLSLAIDAEEPSIIAVVGESGSG
Ga0066654_1034250323300005587SoilMPPLIEAVNVGKRFAGGLGREGTLALAGLSLAIDPERPSVIAVVGE
Ga0066903_10251065323300005764Tropical Forest SoilMKPLVEAVALSKRFAGGLGRESTLALAGLSLSIDAEKP
Ga0068863_10223510723300005841Switchgrass RhizosphereMAPLIEAVDVSKRFAGGFGRESTLALAGLSLAIHAEKPSIIAVVGES
Ga0070766_1064655123300005921SoilMTALIEAVDVAKHFPGGLGREGTLALAGLSLAIDAEQPRIIAVVGESG
Ga0070716_10143823113300006173Corn, Switchgrass And Miscanthus RhizosphereMVSLIEAVDVSKRFARGLGRESTLALAGLSLAIHAEKPSIIAVV
Ga0070712_10056650023300006175Corn, Switchgrass And Miscanthus RhizosphereMVSLIKAVDVSKRFAGGLGRESRLALAGLSLAIHAEKPS
Ga0066665_1126164923300006796SoilMAPLIEAIDASKRFAGGLGREGTLALAGLSLAIGADEPSIIAV
Ga0066660_1102755313300006800SoilMAPLIEAVDLSKRFAGGLGREGTLALAGLSLAIDPERPSVIAVVGES
Ga0099791_1038797323300007255Vadose Zone SoilMVPLIEAVDVSKRFAGGLGREGTLALAGLSLAINAEEPSI
Ga0066710_10245787823300009012Grasslands SoilMSAPLIEAADVSKRFAARFGRESTLALAGLSLAIDAGKPSIIAVVGE
Ga0099828_1110724213300009089Vadose Zone SoilMSQGTSTPLIEAADVSKRFAGRLGRESTLALAGLSLAIHTEKPSIIAVVGESGSGK
Ga0066709_10468354213300009137Grasslands SoilMVPLIEAVDVSKRFPGGLGRESTLALAGLSLAIHAEKPSIIAVVGE
Ga0126376_1094229413300010359Tropical Forest SoilLRDAVAPLIEAVDISKRFSGGLGRESTLALAGLSLAIDAAAP
Ga0126378_1035969313300010361Tropical Forest SoilMPPLIEFVDVNKRFVGGPGREGTLALARFSLAIDAERPSVIAV
Ga0126381_10431893723300010376Tropical Forest SoilLRDAVAPLIEAVNVSKRFAGGLGRESTLALAGLSLAVHAET
Ga0126381_10508550423300010376Tropical Forest SoilMPPLIEAVKVSKQFASRLGREGTLALAGLSLTIDVDAPRVIAVVGESGS
Ga0126383_1003283653300010398Tropical Forest SoilVISLIEAVAVSKRYAGGLGRESTLALAPLSLVIDAERPRVTAVVGESGSGK
Ga0126383_1224172613300010398Tropical Forest SoilLRDAVAPLIEAVDISKRFSGGFGRESTLALAGLSLAI
Ga0137382_1086948613300012200Vadose Zone SoilMPVSHDAMPPLIEAVKVGKRFGGGLGREGTLALGGLSLAID
Ga0137363_1081981723300012202Vadose Zone SoilMSPPLIEAANVSKRFAGGLGREGTLALAGLSLAIDAEKPS
Ga0137371_1133580613300012356Vadose Zone SoilMSGPLIEAANVSKRFAGGFGREGTLALAGLSLAIHAEKPSIIAVVG
Ga0137360_1138166423300012361Vadose Zone SoilMALLIEAIDVSKRFAGAFRREGTLALAGLSLAIDAEEPSIIAVVG
Ga0137410_1083521913300012944Vadose Zone SoilMAPLIEAVDVSKRFAGGLGREGTLALAGLSLAINAEEPSIIAVVGE
Ga0126369_1344292323300012971Tropical Forest SoilMPPLIDAVNVSKRFAGRLGREGTLALAGLSLTIDVDAPR
Ga0157372_1342073913300013307Corn RhizosphereMQPLIEAANVGKRFAGGLGREGTLALAGLSLAIDPERPS
Ga0181518_1015255013300014156BogMPPLIEAVDISKRFAGGLGREATLALAGLSLTIDVAAPRV
Ga0182033_1037521113300016319SoilVIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEKPSVIAV
Ga0182034_1126287213300016371SoilVVPLIEAVDGSKHFAGGMRRESVLALAGLSLAIDAEKPSIIA
Ga0182037_1079960523300016404SoilVREWRAIWRDRMVPMIEAVDVSKRFPGGLGREGTLALAGLSLAIHAEKPSIIAVVGESGS
Ga0182037_1084946523300016404SoilVIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEKPSIIAVVGESGSGK
Ga0182039_1177816023300016422SoilVAALIEAVDISKRFDAGLGRETTLALAPLSLAIHTERPALTAVVGESG
Ga0210403_1013102613300020580SoilMVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAETP
Ga0210403_1096844223300020580SoilMAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPS
Ga0210403_1139286913300020580SoilMVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGE
Ga0210399_1078221423300020581SoilMVPLIEAVDVSKRFAGRLGRESTLALAGLSLAIHSEKP
Ga0210401_1088410023300020583SoilMVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAETPSIIAVVGESGSGK
Ga0210408_1076113613300021178SoilMVPLIEAVDVSKRFAGGLGRESTLALAGLSFAIHAEKPSIIAVVGASGSGKPTVA
Ga0210388_1049700423300021181SoilMVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESGSGK
Ga0207700_1080626013300025928Corn, Switchgrass And Miscanthus RhizosphereMPPLIEAVNVGKRFAGGIGREGTLALAGLSLAIDPERPSVIAVVGE
Ga0207677_1124458623300026023Miscanthus RhizosphereMQPLIEAANVGKRFAGGLGREGTLALAGLSLAIDPE
Ga0209805_106713733300026542SoilMVPLIEAVDVSKRFAGGLGREGTLALAGLSLAIHAEKPSI
Ga0209474_1023705723300026550SoilMVPLIEAVDVSKRFAGGLGREGTLALAGLSLAIHAEKPSPACCSA
Ga0209038_1007496513300027737Bog Forest SoilMVALIEALDVSKRFAHGLGRDSTLALAGLSLAIHAEKPQIIAVVGESGS
Ga0209180_1060560713300027846Vadose Zone SoilMNQGTSIPLIEAAEVSKRFAGRLGRESTLALAGLSLAIHT
Ga0209701_1055639613300027862Vadose Zone SoilMSPALIEAADVSKRFPGGLGREGTLALAGLSLAIDAEKPSIIAVVGESG
Ga0257175_112609713300028673SoilMAPLIEAAAVSKRFAGGLRRDGTLALAELSLAIGADS
Ga0318516_1028031823300031543SoilVIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEK
Ga0318516_1053799213300031543SoilMAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESG
Ga0318534_1087833023300031544SoilVIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEKPSVIAVVG
Ga0318573_1014424213300031564SoilMWRDPVVPLIEAVNASKRFAGGLGRESTLALAGLTLAIH
Ga0318555_1041107913300031640SoilVVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAEKAAIIAVVGESGSGKT
Ga0318542_1014751023300031668SoilLAPLIEAADVSKRFAGGLGRESTLALAGLSLAIYAEKAA
Ga0318542_1045542223300031668SoilMVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPSIIAVVGE
Ga0318561_1001524013300031679SoilMAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAE
Ga0318572_1038314523300031681SoilMVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPSIIAVV
Ga0318560_1030443513300031682SoilMVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPS
Ga0318500_1032992513300031724SoilVVPLIEAVNVSKRFAGGLGRESTLALAGLSLAIHA
Ga0318501_1008814633300031736SoilMPPLIEAVDVSKRFAGRLGREGTLALAGLSLTIDVDAPRVIAVVGESGS
Ga0318492_1057098023300031748SoilMWRDPVVPLIEAVNASKRFAGGLGRESTLALAGLTLAIHAEKPSIIAVVGESGSGK
Ga0307477_1093413613300031753Hardwood Forest SoilMAPLIEAVGLSKRFAGGLGRESTLALAGLSLAIEAE
Ga0318554_1086125923300031765SoilVVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAENPAFISV
Ga0318498_1021330313300031778SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVRE
Ga0318547_1006837113300031781SoilMAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV
Ga0318547_1021824323300031781SoilMWRDPVVPLIEAVDVTKRFAGGLGREGTLALAGLSLAIH
Ga0318529_1060858323300031792SoilMPPLIEAVDVSKRFAGRLGREGTLALAGLSLTIDVDAPRVIAVVGESGSG
Ga0318576_1062106713300031796SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVV
Ga0318565_1019193823300031799SoilMVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPS
Ga0318565_1021140113300031799SoilVIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEK
Ga0318568_1015724533300031819SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEK
Ga0318567_1015112113300031821SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHA
Ga0318499_1012490823300031832SoilVVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPSIIAVV
Ga0310917_1025472033300031833SoilVVPLIEAVDGSKHFAGGMRRESVLALAGLSLAIDAEKPSIIAVVGDSG
Ga0306919_1083995513300031879SoilLAPLIEAADVSKRFAGGLGRESTLALAGLSLAIYAEKAAIIAVVGESGS
Ga0306923_1145216113300031910SoilMTPLIETVSLSKRFAGGLGRESTLALAGLSLAIDATKPSVIAVVGESGSGK
Ga0306921_1200343023300031912SoilLRDAVAPLIEAVDISKRFSGGLGRESTLALAGLSLAIDAE
Ga0310912_1069878513300031941SoilMAPLIEALDVSKCFAGRLWRESTLALAGLSLTIDSEKP
Ga0306926_1191005713300031954SoilVVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAE
Ga0318531_1002509413300031981SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSII
Ga0318531_1027649623300031981SoilVVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPSIIAVVGE
Ga0318563_1021999623300032009SoilVVALIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVV
Ga0318569_1013430023300032010SoilVIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEKPSIIAVVGE
Ga0318549_1019555413300032041SoilMWRDPVVPLIEAVDVTKRFAGGLGREGTLALAGLSLAIHA
Ga0318506_1010024033300032052SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKP
Ga0318505_1022647813300032060SoilMWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESG
Ga0318553_1032977513300032068SoilMAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHA
Ga0306924_1117801923300032076SoilVVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPS
Ga0307470_1049122013300032174Hardwood Forest SoilMAPLIEAVDVGKRFAGGLGRESTLALEGLSLAISAERPAIIAVVGE
Ga0307472_10054782713300032205Hardwood Forest SoilMVPLIEAVDVSKRFPGRLGRESTLALAGLSLAIHA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.