NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105657

Metagenome Family F105657

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105657
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG
Number of Associated Samples 78
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 92.00 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.000 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(65.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.00%    β-sheet: 17.33%    Coil/Unstructured: 70.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03358FMN_red 4.00
PF16499Melibiase_2 3.00
PF13673Acetyltransf_10 3.00
PF00903Glyoxalase 2.00
PF12833HTH_18 2.00
PF02530Porin_2 2.00
PF02687FtsX 2.00
PF00106adh_short 1.00
PF14321DUF4382 1.00
PF00497SBP_bac_3 1.00
PF13561adh_short_C2 1.00
PF00196GerE 1.00
PF00561Abhydrolase_1 1.00
PF07238PilZ 1.00
PF01435Peptidase_M48 1.00
PF00589Phage_integrase 1.00
PF03372Exo_endo_phos 1.00
PF13478XdhC_C 1.00
PF00248Aldo_ket_red 1.00
PF02321OEP 1.00
PF07676PD40 1.00
PF02897Peptidase_S9_N 1.00
PF07719TPR_2 1.00
PF02518HATPase_c 1.00
PF01548DEDD_Tnp_IS110 1.00
PF11236DUF3037 1.00
PF01988VIT1 1.00
PF13365Trypsin_2 1.00
PF07885Ion_trans_2 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 2.00
COG3637Opacity protein LomR and related surface antigensCell wall/membrane/envelope biogenesis [M] 2.00
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 1.00
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 1.00
COG1770Protease IIAmino acid transport and metabolism [E] 1.00
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 1.00
COG3547TransposaseMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ02IWAR1All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
2189573000|GPBTN7E02GWLJVAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300002099|JGI24808J26613_1041405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21634Open in IMG/M
3300002557|JGI25381J37097_1061427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300005162|Ga0066814_10041123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300005332|Ga0066388_101546786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1163Open in IMG/M
3300005602|Ga0070762_10804695All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300005764|Ga0066903_107393299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300006059|Ga0075017_100179726All Organisms → cellular organisms → Bacteria → Acidobacteria1521Open in IMG/M
3300006175|Ga0070712_100034985All Organisms → cellular organisms → Bacteria3407Open in IMG/M
3300006237|Ga0097621_101471250All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300006358|Ga0068871_100649069All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300006854|Ga0075425_102467543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009176|Ga0105242_10878769All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300009177|Ga0105248_11440854All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300009545|Ga0105237_11399810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300010046|Ga0126384_10717644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces violaceusniger887Open in IMG/M
3300010047|Ga0126382_12164327Not Available534Open in IMG/M
3300010048|Ga0126373_10511940All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300010048|Ga0126373_12211354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300010376|Ga0126381_100203584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2648Open in IMG/M
3300011120|Ga0150983_11527094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300012957|Ga0164303_10066768All Organisms → cellular organisms → Bacteria → Acidobacteria1662Open in IMG/M
3300012960|Ga0164301_11460722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300012961|Ga0164302_10028410All Organisms → cellular organisms → Bacteria → Acidobacteria2537Open in IMG/M
3300015200|Ga0173480_10503594All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300015371|Ga0132258_10191551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4954Open in IMG/M
3300015373|Ga0132257_101067755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300016294|Ga0182041_10315452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius1301Open in IMG/M
3300016294|Ga0182041_10404936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1162Open in IMG/M
3300016294|Ga0182041_11158418Not Available704Open in IMG/M
3300016341|Ga0182035_10027107All Organisms → cellular organisms → Bacteria3652Open in IMG/M
3300016371|Ga0182034_10091834All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2148Open in IMG/M
3300016371|Ga0182034_10184738All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300016371|Ga0182034_10702430Not Available860Open in IMG/M
3300016445|Ga0182038_10213949All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300017939|Ga0187775_10158766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300018006|Ga0187804_10427268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium589Open in IMG/M
3300020580|Ga0210403_10002569All Organisms → cellular organisms → Bacteria16325Open in IMG/M
3300020580|Ga0210403_10010555All Organisms → cellular organisms → Bacteria7509Open in IMG/M
3300020580|Ga0210403_10016777All Organisms → cellular organisms → Bacteria5860Open in IMG/M
3300020580|Ga0210403_10023153All Organisms → cellular organisms → Bacteria4962Open in IMG/M
3300020581|Ga0210399_10036136All Organisms → cellular organisms → Bacteria3956Open in IMG/M
3300020581|Ga0210399_11199953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300020581|Ga0210399_11285167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300021168|Ga0210406_10246100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1469Open in IMG/M
3300021170|Ga0210400_11274863All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021171|Ga0210405_10548432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300021178|Ga0210408_10104381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2229Open in IMG/M
3300021180|Ga0210396_10146673All Organisms → cellular organisms → Bacteria → Acidobacteria2121Open in IMG/M
3300021403|Ga0210397_10995438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300021405|Ga0210387_10258970All Organisms → cellular organisms → Bacteria → Acidobacteria1523Open in IMG/M
3300021405|Ga0210387_10426438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1176Open in IMG/M
3300021407|Ga0210383_10763001Not Available829Open in IMG/M
3300021478|Ga0210402_10192246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1873Open in IMG/M
3300021478|Ga0210402_11399751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300021479|Ga0210410_10990179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300021559|Ga0210409_11039796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300025914|Ga0207671_10767301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300025935|Ga0207709_10666432All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300026035|Ga0207703_11661524All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300026295|Ga0209234_1246349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300026959|Ga0207852_1017934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300026995|Ga0208761_1027935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300027050|Ga0209325_1014130All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium911Open in IMG/M
3300027502|Ga0209622_1096289All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300027821|Ga0209811_10059185All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300028379|Ga0268266_10647741All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300028906|Ga0308309_10024409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4047Open in IMG/M
3300028906|Ga0308309_10189851All Organisms → cellular organisms → Bacteria → Proteobacteria1685Open in IMG/M
3300031057|Ga0170834_103029175All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300031057|Ga0170834_108925219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1965Open in IMG/M
3300031231|Ga0170824_128763737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300031446|Ga0170820_11215501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300031474|Ga0170818_103646037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300031545|Ga0318541_10330794Not Available850Open in IMG/M
3300031545|Ga0318541_10549626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300031680|Ga0318574_10827030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300031719|Ga0306917_11186720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031720|Ga0307469_12072947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300031724|Ga0318500_10690297All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300031744|Ga0306918_11523258Not Available511Open in IMG/M
3300031845|Ga0318511_10606129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300031890|Ga0306925_10087503All Organisms → cellular organisms → Bacteria3304Open in IMG/M
3300031890|Ga0306925_10112452All Organisms → cellular organisms → Bacteria → Acidobacteria2908Open in IMG/M
3300031890|Ga0306925_10205652All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300031890|Ga0306925_11690008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300031942|Ga0310916_10155615All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300031946|Ga0310910_10820248All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300031947|Ga0310909_10680977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300031947|Ga0310909_10837991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300031962|Ga0307479_11728272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300032059|Ga0318533_11004689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300032076|Ga0306924_10917954All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300032261|Ga0306920_100712119All Organisms → cellular organisms → Bacteria → Acidobacteria1479Open in IMG/M
3300032261|Ga0306920_101840562Not Available853Open in IMG/M
3300033289|Ga0310914_10229448All Organisms → cellular organisms → Bacteria → Acidobacteria1664Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_005212102170459024Grass SoilKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPTLEARQTAE
N55_098728302189573000Grass SoilMMKHKTMLLEVEPGVTTQFDLTGFAHEIQKVRDPKSQPVLEASRSTE
JGI24808J26613_104140513300002099SoilVEPGVTTQFDMTGLAQEMEKVRTPKTQPILEARQTAG*
JGI25381J37097_106142713300002557Grasslands SoilASVGGDQLLIQDMMEHKTMLLEVEPGVTTQFDVTGLAYELEKVRSTKTQPVLEARQTAG*
Ga0066814_1004112313300005162SoilMMKHETMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLEAGQIAE*
Ga0066388_10154678633300005332Tropical Forest SoilGDSVGGDQFLIQDMMKHKTMLLEIEPGVTAQFDTTGIAREIETARTSETQRVIEARQTAE
Ga0070762_1080469513300005602SoilSANDSVGGDQLLIQEMMKHNRMLLEMEPGVTAQFDMIGLAHEMEKVHTPKTQPVLEARQASE*
Ga0066903_10739329923300005764Tropical Forest SoilGDSVGGDQLLIEDMMKHKTMLLEVEPGVTTQFDMAGLAHEMKKIRTPKAQPMLEARQSDE
Ga0075017_10017972613300006059WatershedsMLLEVEPGVTTQFDMTGLAHEIKKVRAPKTQPVIEARQTAE*
Ga0075030_10087437023300006162WatershedsTMLLEVEPGVTTQFDLTGLAHELEKARNPKMLPVLEARQTER*
Ga0070712_10003498513300006175Corn, Switchgrass And Miscanthus RhizosphereEPGVTTQFDMTGLAHEMEKVRTPKTQPVLESRQTAE*
Ga0097621_10147125023300006237Miscanthus RhizosphereLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKPQPVLEARQTAE*
Ga0068871_10064906913300006358Miscanthus RhizosphereHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKPQPVLEARQTAE*
Ga0075425_10246754313300006854Populus RhizosphereLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKAQPVLEARQTAG*
Ga0105242_1087876923300009176Miscanthus RhizosphereMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG*
Ga0105248_1144085413300009177Switchgrass RhizosphereSVGGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG*
Ga0105237_1139981013300009545Corn RhizosphereMMKHKTMLLEVEPGVTAQFDTTGIAHEIENASTSKSQPVIEARQTAE*
Ga0126384_1071764413300010046Tropical Forest SoilLIQDMMKHRTMLLEVEPGVTAQFDTTGITHEIENARTSKTQPVIEARQTAE*
Ga0126382_1216432713300010047Tropical Forest SoilMLLEVEPGVTAQFDTTGIAHEIENARTSKTQPVIEARQTAE*
Ga0126373_1051194013300010048Tropical Forest SoilMMKHKTMLLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPTLEARQTDE*
Ga0126373_1221135413300010048Tropical Forest SoilDQLLIEDMMKHKTMLLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE*
Ga0126381_10020358443300010376Tropical Forest SoilMKHKAMLLEVEPGVSAQFDTMGIADKIKSASSSKTQSVIEARQTAE*
Ga0150983_1152709423300011120Forest SoilGGDQLLLEDMMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILDASQTAE*
Ga0164303_1006676823300012957SoilIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLEARQTAE*
Ga0164301_1146072213300012960SoilTGDSVGGDQQLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLEARQTAE*
Ga0164302_1002841023300012961SoilVGGDQQLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLEARQTAE*
Ga0173480_1050359423300015200SoilDMMKHKTMLLEVEPGVTAQFDTTGIAHEIENASTSKSQPVIEARQTAE*
Ga0132258_1019155163300015371Arabidopsis RhizosphereEVEPGVATQFDMTGLAHEMEKVRTPKTQPILEARQTAG*
Ga0132257_10106775513300015373Arabidopsis RhizosphereMLLEVEPGITTQFDMTGLKHEMEKVRTPKTQPVLEASQTAW*
Ga0182041_1031545213300016294SoilLLEVEPGVTTQFDITGLGREIEKARAPKTEPVLAATQGEAE
Ga0182041_1040493613300016294SoilGGDQLFIQDMMKHKTMLLEVEPGVTTQFDMTGLADEMEKVRTPKTQPVLEARQTDE
Ga0182041_1115841823300016294SoilPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0182035_1002710773300016341SoilEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0182034_1004404843300016371SoilDSVGGDELFIQDMMKHTAMLLEVEPGVTTQFDVTGLAREIDKARTPKPRAVLAAQQTHE
Ga0182034_1009183413300016371SoilMLLEVEPGVTTQFDMTGLAQEIAKVRTAKTQPVLQAEQTAE
Ga0182034_1018473843300016371SoilPVPEGATGDSVGGDQLLIEDMMKHKTMLLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0182034_1070243013300016371SoilGATGDSVGGDQLLIEDMMKHKTMLLEVEPGVTTQCDMAGLAHEMKKVRTPKAQPMLEARQSGE
Ga0182038_1021394943300016445SoilLLEVEPGVTAQFDMTGLALKMEKARTPKAEPVMEATQTAE
Ga0187775_1015876613300017939Tropical PeatlandVLEGPTGDSVGGDQLLIQDMMKHKTMLLEVEPGVTAQFDMTGLAHEMEKARTPSTQAVIEARQTPE
Ga0187804_1042726813300018006Freshwater SedimentSDPVGGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEIEKARTPKTQPVQ
Ga0210403_10002569173300020580SoilATGDSVGGDQLLLEDMMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILEAGQTAE
Ga0210403_1001055563300020580SoilVGGDQLLLEDMMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILEASQAAE
Ga0210403_1001677713300020580SoilHKTMLLEVAPGVTTQFDIAGLAHEIQKVRAPESQPILEAGQTAE
Ga0210403_1002315313300020580SoilDQQLIQDMMKHETMLLEVEPGVTTQFDLTGLAPEMQKVRTAKAQPVLEARQTTE
Ga0210399_1003613613300020581SoilGDSVGGDQLLLEDMMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILEAGQTAE
Ga0210399_1119995323300020581SoilLEVEPGVTTQFDLTGLAREILKVRAPKSQPILEASQAAE
Ga0210399_1128516723300020581SoilQLLIQDMLKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLESRQTAE
Ga0210406_1024610013300021168SoilETMLLEVEPGVTTQFDLTGLAPEMQKVRTAKAQPVLEARQTTE
Ga0210400_1127486323300021170SoilHKTMLLEVAPGVTTQFDITGLAHEIQKIRAPESQPILEASQTAE
Ga0210405_1054843223300021171SoilKHKTMLLEVAPGVTTQFDMTGLAHEIEKVRNPKAQPVLEASQIAE
Ga0210408_1010438133300021178SoilMMKHKTMLLEVAPGVTTQFDIAGLAHEIQKVRAPESQPILEAGQTAE
Ga0210396_1014667313300021180SoilDSVGGDQLLVQDMIMHKTMLLEVAPGVTTQFDITGLAHEIEKMRTPKTQPVLEAGQIAE
Ga0210397_1099543813300021403SoilQDMMKHKTMLLEVAPGVTTEFDMTGLAHEMEKVRAPKSQPVLEAMQTAE
Ga0210387_1025897013300021405SoilVGGDQLIVQDMMMHKTMLLEVAPGVMAQFDIAGLAHEIEKARTPKTQPVLEAGQVAE
Ga0210387_1042643813300021405SoilGDSVGGDQQLIQDMMKHETMLLEVEPGVTTQFDLTGLAPEMQKVRTAKAQPVLNATQTTE
Ga0210383_1076300123300021407SoilTMLVEVEPGSTTQFEMTGLAHEIQKVRSNKSEPVLDARQTSE
Ga0210402_1019224613300021478SoilMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILEASQAAE
Ga0210402_1139975113300021478SoilDQLLLQDMMKHKTMLLEVEPGVTTQFDTSGLAGEMEKLRTPATQPVLEARQTAE
Ga0210410_1099017913300021479SoilLLLEDMMKHKTMLLEVEPGVTTQFDLTGLAREILKVRAPKSQPILDASQTTE
Ga0210409_1103979623300021559SoilGPTGDSVGGDQLFIQDMMKHKMMLLEVAPGVTTQFDMTGLAHEMEKVRAPNSQPVLEAMQTAE
Ga0207671_1076730113300025914Corn RhizosphereMMKHKTMLLEVEPGVTAQFDTTGIAHEIENASTSKSQPVIEARQTAE
Ga0207709_1066643223300025935Miscanthus RhizosphereKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG
Ga0207703_1166152423300026035Switchgrass RhizosphereFVQDMMKHKTMLLEVEPGITTQFDITGLAHELEKVHSRKTEPVLEARQTAG
Ga0209234_124634923300026295Grasslands SoilLIQDMMEHKTMLLEVEPGVTTQFDVTGLAYELEKVRSTKTQPVLEARQTAG
Ga0207852_101793423300026959Tropical Forest SoilEDMLQHKTVLLEVEPGITAQFDLTGLAHEMDKARAPKTQPVIEAKQTTD
Ga0208761_102793513300026995SoilMMKHETMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLEAGQIAE
Ga0209325_101413023300027050Forest SoilPTGDSVGGDQLLIQEMMKHKTMLLEVEPGITTQFDITGLAHELEKVRSTKTEPALEARQTAG
Ga0209622_109628913300027502Forest SoilGDSVGGDQLLIEDMMKHRSMLLEVEPGVTTQFDITGLTHEIEKARTRKAQPVLEARQTAE
Ga0209811_1005918523300027821Surface SoilSIGGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG
Ga0268266_1064774113300028379Switchgrass RhizosphereLDGATGDSVGGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTPKTQPVLEARQTAG
Ga0308309_1002440933300028906SoilMIMHKTMLLEIAPGVTTQFDIAGLAHEIEKMRTPKTQPVLEAGQIAE
Ga0308309_1018985143300028906SoilMLLEVEPGLTTQFDITGLAHEIEKVRTAKTESVLEARQTAE
Ga0170834_10302917513300031057Forest SoilMKHKTMLLEVEPGVTTQFDLTGLAHEILKVRAPKSQPIFEASQTAE
Ga0170834_10892521933300031057Forest SoilVLEGATGDSVGGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRAPKTQPVLEARQTAG
Ga0170824_12876373713300031231Forest SoilPGVTTQFDITGLAHEMEKVRTPKTQPVLEARQTAG
Ga0170820_1121550113300031446Forest SoilKTMLLEVEPGATTQFDVTGLAHEIEKVRTTKTQPVLEARQASE
Ga0170818_10364603713300031474Forest SoilDMLKHKTMLLEVEPGVTTQFDMTGLAHEMEKVRTSKTQPVLESRQTAE
Ga0318541_1033079413300031545SoilEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0318541_1054962613300031545SoilGDQLLIQDMMKHKTMLLEVEPGVTTQFDMTGLADEMEKVRTPKTQPVLEARQTDE
Ga0318574_1082703013300031680SoilIEDMMKHKAMLLEVEPGVTTQFDMAGLAQEMKKVRTPKAQPMLEARQTDE
Ga0306917_1118672013300031719SoilLLIQEMTKHAAMLLEVEPGVTTQFDITGLGREIEKARAPKTEPVLAATQGEAE
Ga0307469_1207294723300031720Hardwood Forest SoilVGGDQLLIQDILKHKTMLLEVEPGVTTQFDLTGLEHEMEKVRTPKTQPVLEARQTAG
Ga0318500_1069029713300031724SoilHKTMLLEVEPGVTTQFDMAGLAHEMKKIRTPKAQPMLEARQSDE
Ga0306918_1152325813300031744SoilLIEAMKKHKTMLLEVEPGGTAQFDMTGLAHEMAKARTPKTQPVLEAEQTAE
Ga0318511_1060612913300031845SoilIGPVPEAATGDSVGGDQLLIEDMMNHKAMLLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0306925_1008750363300031890SoilLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0306925_1011245233300031890SoilEEMMKHKTMLLEVEPGVTTQFDMTGLAQEIAKVRTAKTQPLLQAEQTAE
Ga0306925_1020565243300031890SoilVGGDQLLIQDMMKHKTMLLEVEPGVTAQFDTTGIAHEIENARISKTQPIIEARQTAE
Ga0306925_1169000823300031890SoilGGDQLLIEDMMKHKAMLLEVEPGVTTQFDMAGLAQEMKKVRTPKAQPMLEARQTDE
Ga0310916_1015561513300031942SoilHKTMLLEVEPGVTTQFDMAGLAHEMKKVRTPKAQPMLEARQTDE
Ga0310910_1082024813300031946SoilSVGGDQLLIQEMMKHKTMLLEVEPGVAAQFDIAGLADEMEKVRTPKTQAVLEARQSSE
Ga0310910_1111874813300031946SoilKHTAMLLEVEPGVTTQFDVTGLAREIDKARTPKPRAVLAAQQTHE
Ga0310909_1068097723300031947SoilMLLEVEPGVTTQFDMAGLAHEMKKIRTPKAQPMLEARQSDE
Ga0310909_1083799123300031947SoilMMKHKTMLLEVEPGVTTQFDIGELAHELERVRTHKAQPMLEARQSAE
Ga0307479_1172827213300031962Hardwood Forest SoilGGDQLLLQDMMKHKTMLLEVAPGVTTQFDIAGLAHEIQKVRAPESQPILEAGQTAE
Ga0318533_1100468913300032059SoilLEVEPGITTQFDTTGLAQKIESVRTDKTQPVLDARQTVE
Ga0306924_1091795423300032076SoilKTMLLEVEPGVAAQFDIAGLADEMEKVRTPKTQAVLEARQSSE
Ga0306920_10071211913300032261SoilRHKTMLLEVEPGVTTQFDMTGLAHEIEKVRTAKTQPVLDARQTAE
Ga0306920_10184056213300032261SoilLEVEPGVTAQFDMTGLALKMEKARTPKAEPVMEATQTAE
Ga0310914_1022944813300033289SoilAPESVTADSVGGDQLLIEEMMKHKTMLLEVEPGVTTQFDMTGLAQEIAKVRTAKTQPVLQAEQTAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.