Basic Information | |
---|---|
Family ID | F105480 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 42 residues |
Representative Sequence | HAIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQTSKSDEK |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 15.00 % |
% of genes from short scaffolds (< 2000 bps) | 15.00 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (86.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 0.00% Coil/Unstructured: 83.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF03976 | PPK2 | 13.00 |
PF13466 | STAS_2 | 8.00 |
PF00999 | Na_H_Exchanger | 5.00 |
PF07885 | Ion_trans_2 | 5.00 |
PF06897 | DUF1269 | 4.00 |
PF00479 | G6PD_N | 3.00 |
PF03446 | NAD_binding_2 | 3.00 |
PF03729 | DUF308 | 2.00 |
PF09335 | SNARE_assoc | 2.00 |
PF00881 | Nitroreductase | 2.00 |
PF00231 | ATP-synt | 1.00 |
PF00497 | SBP_bac_3 | 1.00 |
PF00873 | ACR_tran | 1.00 |
PF13194 | DUF4010 | 1.00 |
PF00232 | Glyco_hydro_1 | 1.00 |
PF04632 | FUSC | 1.00 |
PF02470 | MlaD | 1.00 |
PF09364 | XFP_N | 1.00 |
PF13701 | DDE_Tnp_1_4 | 1.00 |
PF00211 | Guanylate_cyc | 1.00 |
PF02405 | MlaE | 1.00 |
PF00916 | Sulfate_transp | 1.00 |
PF00768 | Peptidase_S11 | 1.00 |
PF00391 | PEP-utilizers | 1.00 |
PF02781 | G6PD_C | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 13.00 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 5.00 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 5.00 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 5.00 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 5.00 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 5.00 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 4.00 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 4.00 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.00 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.00 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 2.00 |
COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 1.00 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.00 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 1.00 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.00 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.00 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.00 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 86.00 % |
All Organisms | root | All Organisms | 14.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001431|F14TB_100420967 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005555|Ga0066692_10281294 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300005764|Ga0066903_103720108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
3300006852|Ga0075433_10414784 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300010329|Ga0134111_10053322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1472 | Open in IMG/M |
3300010359|Ga0126376_11861044 | Not Available | 641 | Open in IMG/M |
3300010362|Ga0126377_10387608 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300010400|Ga0134122_12101779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
3300012202|Ga0137363_10177474 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
3300012353|Ga0137367_10210816 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300012948|Ga0126375_10137784 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300013306|Ga0163162_11221222 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 853 | Open in IMG/M |
3300027880|Ga0209481_10245676 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 901 | Open in IMG/M |
3300031720|Ga0307469_12279138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300032160|Ga0311301_11820520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 723 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.00% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_3926040 | 2035918004 | Soil | AILRAIRGLGGTVLKSNVDAERARLIQSTLAAASAPPHKPGS |
F64_04085320 | 2170459011 | Grass Soil | EMILQTLRGLGGTVLKTNVDVDRAKLIQSTLAAVDTVKPGDK |
JGI1027J12803_1063785332 | 3300000955 | Soil | QGLGGTVLRTNVDVKRAKLIQSTLAAAAADTSKPDDQ* |
JGI1027J12803_1096471551 | 3300000955 | Soil | HAIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQTSKSDEK* |
JGI10216J12902_1115401581 | 3300000956 | Soil | GDMDVILHKIRGLGGTVLKTNVDVEHARLIQSTLAAPSTQPGKSDAK* |
F14TB_1004209671 | 3300001431 | Soil | GDMDVILHGIRGLGGTVLKTNVDMERARLIQSTLATPSAQPSKGEGG* |
Ga0070708_1004234481 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TIRGLGGTVLKTNVDLERAQLIQSVLAAPSAQPSRPGGQ* |
Ga0070695_1017251661 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GDMDVILHKIRGLGGTVLKTNVDVEHAKVIQSTLAAPSAQTNKSDDK* |
Ga0066701_101339141 | 3300005552 | Soil | VILHGIRGLGGTVLKTNVDVERARLIQSTLAAPSEHATKADAE* |
Ga0066692_102812941 | 3300005555 | Soil | QGDMDVILHGIRGLGGTVLKTNVDVERARLIQSTLAAPSEHAPKADADSLPRS* |
Ga0066708_104097541 | 3300005576 | Soil | IRGLGGTVLKTNVDVERARLIQSTLAAPSEHATKADAE* |
Ga0066905_1010830152 | 3300005713 | Tropical Forest Soil | DMDVILHAIRGLGGTVLKSNVDTQRAQLIQTTLAAPSAQKHKSDDK* |
Ga0066905_1014238551 | 3300005713 | Tropical Forest Soil | GLGGIVLKSNVDRERAQLIQATLAAPSAQTSRSEEK* |
Ga0068866_105960071 | 3300005718 | Miscanthus Rhizosphere | ILHAIRGLGGTVLKTNVDLERAQLIQSTLAAPSQTSKSDDKS* |
Ga0066903_1014659674 | 3300005764 | Tropical Forest Soil | MDVILHAIRGLRGTVLKTNVDLERAQLIQSTLAAPSAQPGKSDAK* |
Ga0066903_1037201081 | 3300005764 | Tropical Forest Soil | PHSPARRSAPSMDVRLHKIRGLGGTVLKTNVDLERAQLIQSALAAPPTQPGKSDAK* |
Ga0066651_108042451 | 3300006031 | Soil | RGLGGTVLKTNVDLERARLIQSTLAAPSAQTSKPDVK* |
Ga0075029_1003732832 | 3300006052 | Watersheds | MDAILHAIRGLGGTVLKSNVDLERVKLIQATLAASAGTTQSNDL* |
Ga0075427_100841641 | 3300006194 | Populus Rhizosphere | IQGLGGTVLRTNVDVKRAKLIQSTLAAAAADTSKPDGQ* |
Ga0075427_101068022 | 3300006194 | Populus Rhizosphere | GGTVLKTNVDLERAQLIQSTLAAPSAQTNKSDDK* |
Ga0075021_107849291 | 3300006354 | Watersheds | LGGTVLKTNVDLERAKLIQSTLAAASTDTSKPNGE* |
Ga0075428_1019719771 | 3300006844 | Populus Rhizosphere | RGLGGTVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0075431_1013978923 | 3300006847 | Populus Rhizosphere | IRGLGGMVLKTNVDLERAQLIQSTLAAPSAQTNKSDDK* |
Ga0075433_104147843 | 3300006852 | Populus Rhizosphere | DMDVILHGIRGLGGTVLKTNVDLERARLIQSTLAVSVAQTTRPATD* |
Ga0075433_107949382 | 3300006852 | Populus Rhizosphere | LGGTVLKTNVDVERARLIQSTLAEGSAPTNKPDGR* |
Ga0075425_1000761841 | 3300006854 | Populus Rhizosphere | MDVILHKIRGLGGTVLKTNVDLERTKLIQSTLAAASTDPSKPDGQ* |
Ga0075425_1031339302 | 3300006854 | Populus Rhizosphere | LHKIRGLGGTVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0075424_1014658731 | 3300006904 | Populus Rhizosphere | RGLGGTVLKTNVDMERAQLIQSTLTATSAQTRKSDDKE* |
Ga0075419_112609461 | 3300006969 | Populus Rhizosphere | IRGLGGTVLKTNVDRERAQLIQSTLAAPSAQTSKSDGK* |
Ga0114129_109725763 | 3300009147 | Populus Rhizosphere | IQGLGGTVLRTNVDLQRAQLIQSTLAAASADTSKPENEP* |
Ga0114129_116114661 | 3300009147 | Populus Rhizosphere | LHAIRGLGGTVLKTNVDVERAQLIQSTLSATSADRSKLDDKL* |
Ga0075423_112724391 | 3300009162 | Populus Rhizosphere | IRGLGGTVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0105249_103921151 | 3300009553 | Switchgrass Rhizosphere | IRGLGGTVLKTNVDLERVQLIQSTLAAPSQTSKSDDKS* |
Ga0105249_107190942 | 3300009553 | Switchgrass Rhizosphere | HGIRGLGGTVLKTNVDVERARLIQSTLAAPSAQTNKVDGA* |
Ga0116215_11633392 | 3300009672 | Peatlands Soil | MDAILHAIRGLGGTVLKSNNVDLERVKLIQATLAASAGTTQSNDL* |
Ga0126380_100604574 | 3300010043 | Tropical Forest Soil | QGLGGTVLRTNVDVKRAQLIQSTLAAAAADTSKPE* |
Ga0126380_104401283 | 3300010043 | Tropical Forest Soil | LGGTVLRTNVDVKRAQLIQSTLAAAAADTSKPDDQ* |
Ga0126384_105178111 | 3300010046 | Tropical Forest Soil | MEVILHAIQGLGGTVLRTNVDLERAKLIQSTLAAASAQTGKSDDK* |
Ga0126382_106414832 | 3300010047 | Tropical Forest Soil | LGGTVLKTNVDMERAKLIQSTLAAAPAATMKPAKQ* |
Ga0127493_10417251 | 3300010130 | Grasslands Soil | HGIRGLGGTVLKTNVDVERARLIQSTLAAAPSASSPS* |
Ga0134111_100533223 | 3300010329 | Grasslands Soil | EGDMDVILHTIRGLGGTVLKTNVDLERARLIQSTLAAPSAQTSKPDVK* |
Ga0134080_103153362 | 3300010333 | Grasslands Soil | RIRSLGGTVLKTNVDLGRARLIQSILAAFSAQTSKPDVK* |
Ga0126376_118610442 | 3300010359 | Tropical Forest Soil | ILHALQGLGGTVLRTNVDVQRAQLIQSTLAAAAADTNKPDGQ* |
Ga0126372_103844411 | 3300010360 | Tropical Forest Soil | VILGAIRGLGGTVLKTNVDMERARLIQSTLAAPSTSKSDDK* |
Ga0126377_103876081 | 3300010362 | Tropical Forest Soil | DDAGDMDVILHAIRGLGGTVLKSNVDTQRAQLIQTTLAAPSAQKHKSDDK* |
Ga0126379_125411551 | 3300010366 | Tropical Forest Soil | VILHRIRGLGGTVLKTNVDLERAQLIQSTLAAPATRTSKSDDK* |
Ga0134122_121017792 | 3300010400 | Terrestrial Soil | EGDMDVILHRIRGLGGTVLKTNVDMERARLIQSTLAASSVQTSKPGGD* |
Ga0134123_113075002 | 3300010403 | Terrestrial Soil | GGSVLKTNVDVEHAKLIQSTLAAPSAQTNKSDEK* |
Ga0137392_112791452 | 3300011269 | Vadose Zone Soil | DVILHRIRGLGGTVLKTNVDLERAQLIQSTLAVPSAQMDKSDDKS* |
Ga0137389_113942942 | 3300012096 | Vadose Zone Soil | MDVILHKIQGLGGTVLKTNVDLERAKLIQATLAASSDQTLRPNGK* |
Ga0137363_101774741 | 3300012202 | Vadose Zone Soil | EGDMDVILGAIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQTIKSDGK* |
Ga0137376_107516622 | 3300012208 | Vadose Zone Soil | DVILLTIRGLGGTVLKTNVDLEQAQLIQSTLAAPSAQTSKSDDK* |
Ga0137372_101728554 | 3300012350 | Vadose Zone Soil | RGLGGTVLKTNVDLEHAQLIQSTLAAPPAQTSKSDDK* |
Ga0137367_102108164 | 3300012353 | Vadose Zone Soil | GGTVLKTNVDLERAQLIQSTLAAPSAQTSKPDDK* |
Ga0137366_104730241 | 3300012354 | Vadose Zone Soil | RGLGGTVLKTNVDVEHAKLIQSTLAAPSAQTSESEDK* |
Ga0137360_101698481 | 3300012361 | Vadose Zone Soil | GLGGTVLKTNVDLERAQLIQSTLAAASAQTSKSAEK* |
Ga0137373_112133542 | 3300012532 | Vadose Zone Soil | LHAIRGLGGTVLKTNVDLERARLIQSTLAASSAQTNKSESK* |
Ga0137396_106705022 | 3300012918 | Vadose Zone Soil | EVILHAIRGLGGTVLRTNVDLERAKLIQSTLAAAAAATSKPDGQ* |
Ga0137404_100090297 | 3300012929 | Vadose Zone Soil | MDMILHGIRGLGGTVLKTNVDVERARLIQSTLAAPSAQTNKVDCE* |
Ga0137407_104628442 | 3300012930 | Vadose Zone Soil | ILHKIRGLGGTVLKTNVDRERAQLIQSTLAAPSAQTSKSDGK* |
Ga0137407_108978792 | 3300012930 | Vadose Zone Soil | ILHKIRGLGGTVLKTNVDRERAQLIQSTLAAPSAQTSKSDEK* |
Ga0137407_112596022 | 3300012930 | Vadose Zone Soil | VILHKIRGLGGTVLKTNVDREHAQLIQSTLAAPSTQPGKSDAK* |
Ga0126375_101377843 | 3300012948 | Tropical Forest Soil | GDMDVILSRIRGLGGTLLKTNVDVERARLIQSTLASPPAQRGKAEGG* |
Ga0126375_108028271 | 3300012948 | Tropical Forest Soil | HKIRGLGGTVLKTNVDLEHARLIQSTLAAPAAQTSKSDDK* |
Ga0163162_112212221 | 3300013306 | Switchgrass Rhizosphere | GDMDVILHKIRGLGGSVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0134081_100607252 | 3300014150 | Grasslands Soil | MDVILHRIRGLGGTVLKTNVDLERARLIQSTLAAPSAQTSKPDVK* |
Ga0137418_111632951 | 3300015241 | Vadose Zone Soil | IRGLGGTVLKTNVDLERAQLIQSTLAVPSAQTSKSDGK* |
Ga0180093_10645581 | 3300015258 | Soil | LGGTVLKTNVDRERAQLIQSTLAAPSTQPGKSDAK* |
Ga0132255_1055262202 | 3300015374 | Arabidopsis Rhizosphere | DVILHKIRGLGGSVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0132255_1057816172 | 3300015374 | Arabidopsis Rhizosphere | ILHKIRGLGGSVLKTNVDVEHAKLIQSTLAAPSAQTNKSDDK* |
Ga0182039_107202971 | 3300016422 | Soil | PGDMDVILHKIRGLGGTVLKTNVDLERAQLIQSTLAAPSTQPGKSDAK |
Ga0134112_101648241 | 3300017656 | Grasslands Soil | ILHTIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQPSRPGGQ |
Ga0134112_102258142 | 3300017656 | Grasslands Soil | RGLGGTVLKTNVDLERARLIQSTLAASSAQTNKSESK |
Ga0134083_103777182 | 3300017659 | Grasslands Soil | RGLGGTVLKTNVDLERARLIQSTLAAPSAQTSKPDVK |
Ga0187778_101619161 | 3300017961 | Tropical Peatland | ILHAIRGLGGTVLKSNNVDLERVKLIQATLAASAGTTQSNDL |
Ga0184638_12278151 | 3300018052 | Groundwater Sediment | HAIRGLGGTVLKTNVDLEHAQLIQSTLAAPSAQTSKSDDK |
Ga0190269_107258541 | 3300018465 | Soil | LHAIQGLGGTVLRTNVDLQRAKLIQSTLAAALADTSKPDGQ |
Ga0213877_102445352 | 3300021372 | Bulk Soil | AILHAIRGLGGTVLKTNVDPERARLIQSTLAASADTTQPNGQ |
Ga0207644_108478482 | 3300025931 | Switchgrass Rhizosphere | IRGLGGTVLKTNVDLERAQLIQSTLAAPSTQIDKSDDKA |
Ga0209055_10129396 | 3300026309 | Soil | IRGLGGTVLKTNVDVERARLIQSTLAAPSERATKADAE |
Ga0209684_10016112 | 3300027527 | Tropical Forest Soil | MDVILHAIRGLRGTVLKTNVDLERAQLIQSTLAAPSAQPGKSDAK |
Ga0209481_102456762 | 3300027880 | Populus Rhizosphere | DEGDMDVILHRIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQPSKSDSK |
Ga0209068_106083432 | 3300027894 | Watersheds | IRGLGGTVLKTNVDLERAKLIQSTLAAASTDTSKPNGE |
Ga0247827_108459301 | 3300028889 | Soil | IQGLGGTVLRTNVDLERAQLIQSTLAAAAAGTSKPDGQ |
Ga0307497_104407902 | 3300031226 | Soil | GLGGTVLKTNVDLERAQLIQSTLAAPSAQTSKSDEK |
Ga0318516_100413861 | 3300031543 | Soil | MDVILYRIRGLGGTVLKTNVDLERAQLIQSTLSAAPEQSSKPDGE |
Ga0318515_101666712 | 3300031572 | Soil | VILYRIRGLGGTVLKTNVDLERAQLIQSTLSAAPEQSSKPDGE |
Ga0318574_103445051 | 3300031680 | Soil | MDVILYRIRGLGGTVLKTNVDLERAQLIQSTLSAAPEQSSKPDDE |
Ga0307469_122791382 | 3300031720 | Hardwood Forest Soil | EGDMDVILHAIRGLGGTVLKTNVDVDRARVIQSTLAAPSAQTSRADGE |
Ga0306923_108490011 | 3300031910 | Soil | ILHKIRGLGGTVLKTNVDLERAQLIQSTLAAPSTQPGKSDAK |
Ga0306926_104616292 | 3300031954 | Soil | MDVILYRIRGLGGTVLKTNVDLERARLIQSTLAASAATTQPNGQ |
Ga0318532_102311271 | 3300032051 | Soil | LGGTVLKTNVDLERAQLIQSTLSAAPEQSSKPDGE |
Ga0311301_105163353 | 3300032160 | Peatlands Soil | MDAILHAIRGLGGTVLKSNNVDLERVKLIQATLAASAGTTQSNDL |
Ga0311301_118205203 | 3300032160 | Peatlands Soil | MEVILHTIQGLGGTVIKTNVDLERARLIESTLAGAPAEVATSSRTGQ |
Ga0307470_110362612 | 3300032174 | Hardwood Forest Soil | IRGLGGTVLKTNVDLERAQLIQSTLAAPSAQTSKSDVK |
Ga0307471_1015115471 | 3300032180 | Hardwood Forest Soil | IRGLGGTVLKTNVDVERARLIQSTLAEQSAPTSKPDCN |
Ga0306920_1032464262 | 3300032261 | Soil | EDVILHALRGLGGTVLRTNVDLERARLIQSTLAAPADTTQPGES |
Ga0335079_115696541 | 3300032783 | Soil | LGAIRGLGGTVLKTNVDLERAQLIQSTLAAPSAQTSKSDVK |
Ga0247830_111436452 | 3300033551 | Soil | IQGLGGTVLRTNVDLERVQLIQSTLAAAAAGTSKPDGQ |
Ga0364943_0044770_845_982 | 3300034354 | Sediment | MDVILHKIRGLGGTVLKTNVDREHAQLIQSTLAAPSTQPGKSDAK |
⦗Top⦘ |