| Basic Information | |
|---|---|
| Family ID | F105463 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VLREATGIVGDVKAIASTGLRAVRTRLELLAIELKEEKAW |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF05957 | DUF883 | 83.00 |
| PF04972 | BON | 13.00 |
| PF00486 | Trans_reg_C | 1.00 |
| PF01594 | AI-2E_transport | 1.00 |
| PF13560 | HTH_31 | 1.00 |
| PF00563 | EAL | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 83.00 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.00 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.00 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.00 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.00 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_4282490 | 2032320006 | Soil | MRVDRESTGLIGDVKGIASTGLRAIRTRLELAVIELTEQKAWAARFLVVAG |
| INPhiseqgaiiFebDRAFT_1005437941 | 3300000364 | Soil | MRVDRESTGLIGDVKGIACTALRAARTRLELAVIELTEQKAWAMRFL |
| JGI10216J12902_1009422245 | 3300000956 | Soil | VLREAAGAVGDLKGIASTGLRAVRTRLELLAIEVKEEKA |
| JGI10216J12902_1068678721 | 3300000956 | Soil | MLREAAGAVGDLKGLASTSVRALRTRLELLAIEVKEEKA |
| Ga0007429J51699_10952362 | 3300003579 | Avena Fatua Rhizosphere | VDRDRESGGLIGDIRGIASTGLRAVRTRLELAAIELSEEKAW |
| Ga0062589_1015422222 | 3300004156 | Soil | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQKAWAARFFVVAVSGLYLVTF |
| Ga0062595_1017317881 | 3300004479 | Soil | VNRESTGIIGDVKGLASTGLRAVRTRLELAAIELSEEKAWAVRFLVVAVAGLYLVT |
| Ga0058861_115074492 | 3300004800 | Host-Associated | MGVIREASGIVSDVRGLASTGLRAVRTRLELLAIELKEEK |
| Ga0065712_101877511 | 3300005290 | Miscanthus Rhizosphere | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQKAWAVRFLVVAVAGLYL |
| Ga0070666_110984622 | 3300005335 | Switchgrass Rhizosphere | VIREATSIVGDLKGLAGTGVRAIRTRLELLAIELKEEKAWLVRL |
| Ga0068868_1004965151 | 3300005338 | Miscanthus Rhizosphere | VIGEAVGALGDMKGVFATGVRAVRTRLELLALEVSEEKAWTVRF |
| Ga0070661_1006326991 | 3300005344 | Corn Rhizosphere | VIREASNIVGDVRGIAATGVRAVRTRLELLVIELKEEKAWIV |
| Ga0070671_1020826332 | 3300005355 | Switchgrass Rhizosphere | VLRQATGIVGDVKGLASTGLRALRTRLELLAIELKEEKAWAARF |
| Ga0070659_1018344842 | 3300005366 | Corn Rhizosphere | VIREASNIVGDVRGIAATGVRAVRTRLELLVIELKEEKAWI |
| Ga0070700_1011577461 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRDATSMIGDIRGIASTGVRAVRTRLELVAIELKEEKAWLV |
| Ga0070662_1015014832 | 3300005457 | Corn Rhizosphere | MAREHPGLIGDVASIASNGLRAIRTRLELLTIELKEEKAWVVRFIVV |
| Ga0070698_1017142782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VIREATSIVGDLKSLAATGVRAVRTRLELMTIELKEEKAWL |
| Ga0070679_1011696152 | 3300005530 | Corn Rhizosphere | VIREATSIVGDLKGLAGTGVRAIRTRLELLAIEVKEEKAWLVRLLIVAIA |
| Ga0070697_1020005681 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEASAPREATGIVGDIKGIASTGLRAVRTRLELLAIELKEEKAWTV |
| Ga0068855_1011249211 | 3300005563 | Corn Rhizosphere | MGVIREATGIVGDVRGLASTGLRAIRTRLELLAIELKEEKAW |
| Ga0068855_1019502193 | 3300005563 | Corn Rhizosphere | MGVIREATGIVGDVKGLASTGIRAVRTRLELLAIELAEEKAWLVRYVV |
| Ga0068852_1001350851 | 3300005616 | Corn Rhizosphere | VIRQVSGIVGDVRGLASTGLRAVRTRLELAVIELTEEKAWIVRFI |
| Ga0068852_1009187034 | 3300005616 | Corn Rhizosphere | MGVIREASGIVGDVRGLASTGLRAVRTRLELLAIELKEEKAWAVRS |
| Ga0068861_1020330021 | 3300005719 | Switchgrass Rhizosphere | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSE |
| Ga0075283_10511411 | 3300005891 | Rice Paddy Soil | VLRQVSGIVGDVRGIAHTGVRAVRTRLELASIELSEEKAWL |
| Ga0075279_100142581 | 3300005903 | Rice Paddy Soil | VLRQVSGIVGDVRGIAHTGVRAVRTRLELASIELSEEKAWLVRFVL |
| Ga0075422_102011541 | 3300006196 | Populus Rhizosphere | MLREAAGAVGDLKGLATTSVRALRTRLELLAIEVKEEK |
| Ga0074048_120875203 | 3300006581 | Soil | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQRAWAARFLVVAVA |
| Ga0075426_111833041 | 3300006903 | Populus Rhizosphere | VLREATGVVGDIKAIASTGLRAVRTRLELLAIELKEEKAW |
| Ga0079219_115101692 | 3300006954 | Agricultural Soil | VLREASGIVGDVKGVATTGLRAVRTRLELFAIELKEEKAWAMRFLLVAVCALYL |
| Ga0075418_100652196 | 3300009100 | Populus Rhizosphere | MLREAAGAVGDLKGLATTSVRALRTRLELLAIEVKEEKAWAMRFIV |
| Ga0105243_103810381 | 3300009148 | Miscanthus Rhizosphere | LRVDRESTGLIGDVKGIASTGLRAIRTRLELAVIELAEQKAWAMRFLVVAVAGLYLVT |
| Ga0105242_120086181 | 3300009176 | Miscanthus Rhizosphere | VIGEAVGAIGDLKGVVSTGVRAVRTRLELLALEVKEEKAWTVRFI |
| Ga0105238_128613431 | 3300009551 | Corn Rhizosphere | VDRESTGLIGDVKGIASTGLRAIRTRLELAVIELTEQKAWAVRFLVVAVAG |
| Ga0105858_10253741 | 3300009661 | Permafrost Soil | VTREPTGIIADVKAIASTGLRAVRTRLELLAIELSEEK |
| Ga0134128_109786651 | 3300010373 | Terrestrial Soil | MAGEATGLVGDVRGLAGTALRAVRTRLELLAIEASEEKAWALRFLVVAVA |
| Ga0105239_104237021 | 3300010375 | Corn Rhizosphere | VIREATNIVGDLKGLAETGVRAVRTRLELMAIEFKEEKAW |
| Ga0105239_124087202 | 3300010375 | Corn Rhizosphere | VLREATGVVGDIKAIASTGLRAVRTRLELLAIELKEEKAWVVRLLVVAV |
| Ga0134122_105370651 | 3300010400 | Terrestrial Soil | VDRESTGLIGDVKGIASTGLRAIRTRLELAVIELAEQKA |
| Ga0134123_134693891 | 3300010403 | Terrestrial Soil | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKTWAVRFLVV |
| Ga0105246_117061131 | 3300011119 | Miscanthus Rhizosphere | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKAWAVRFLVVAVAGL |
| Ga0127502_105666852 | 3300011333 | Soil | MLREAAGAVGDLKGLASTGVRAVRTRLELLAIEVK |
| Ga0137357_11080622 | 3300012168 | Soil | MLREAAGAVGDLKGLAATSVRALRTRLELLAIEVKEE |
| Ga0150985_1109805562 | 3300012212 | Avena Fatua Rhizosphere | MGVIREASGIVGDVRGLASTGLRAVRTRLELLAIE |
| Ga0137370_109623861 | 3300012285 | Vadose Zone Soil | VLREATGIVGDIKGIASTGLRAVRTRLELLAIELKEEKAWAVRC |
| Ga0150984_1058884281 | 3300012469 | Avena Fatua Rhizosphere | VDRESTGLLGDVRGIASAGLRAIRTRLELAAIELSE |
| Ga0150984_1071920152 | 3300012469 | Avena Fatua Rhizosphere | VIREATSIVGDLKGLAGTGVRAVRTRLELLAIEVKEEKAWLV |
| Ga0150984_1101239432 | 3300012469 | Avena Fatua Rhizosphere | VIREATSIVGDLKGLAGTGVRAIRTRLELLAIEVKEEKAWLGRLGIG |
| Ga0150984_1167488112 | 3300012469 | Avena Fatua Rhizosphere | MIREASNIVGDLRGLASTGVRAVRTRLELIAIELK* |
| Ga0157292_102792892 | 3300012900 | Soil | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKTWAVRFLVVA |
| Ga0164303_108290193 | 3300012957 | Soil | VIREATNIVGDVRGIAATGVRAVRTRLELVAIELKEE |
| Ga0134110_101834561 | 3300012975 | Grasslands Soil | VPREATGIVGDIKGIASTGLRAVRTRLELIAIELKEEKVWAVRCLIA |
| Ga0164308_105553261 | 3300012985 | Soil | MRVDRESTGLIGDVKGIASTGLRAIRTRLELAVIE |
| Ga0157378_124201601 | 3300013297 | Miscanthus Rhizosphere | VDRESTGIIGDLKGLASTGLRAIRTRLELAAIELAEQKAWALRFL |
| Ga0163162_119282882 | 3300013306 | Switchgrass Rhizosphere | VERESTGLIGDVKGIASTGLRAIRTRLELAAIEITEQKEWAMRFLVVAVAGLYFVT |
| Ga0157380_102288941 | 3300014326 | Switchgrass Rhizosphere | MLREAAGAVGDLKGLATTGVRAVRTRLELLAIEVKEEKAWAIRFIV |
| Ga0180068_10879902 | 3300014864 | Soil | MLREAAGAVGDLKGLAATSVRALRTRLELLAIEVKEEKAWAMRFIVFALAALYLL |
| Ga0157376_102669741 | 3300014969 | Miscanthus Rhizosphere | VERESTGLIGDVKGIASTGLRAIRTRLELAAIEITEQKEWAMRF |
| Ga0167655_10357022 | 3300015086 | Glacier Forefield Soil | VIREATNIVGDLRGLASTGVRAVRTRLELVAIELKEEKAWAVR |
| Ga0180067_10368023 | 3300015257 | Soil | VIREATGIVGDVKGLAATGLRAVRTRLELLGIELKEEK |
| Ga0180093_10147104 | 3300015258 | Soil | MLREAAGAVGDLKGLAATSVRALRTRLELLAIEVKEEKAWAM |
| Ga0163144_109386031 | 3300015360 | Freshwater Microbial Mat | VIREATSIVGDLRGIASTGVRAVRTRLELVVIELKEEKAWVVRSI |
| Ga0187824_101170882 | 3300017927 | Freshwater Sediment | VLRQASGIVGDVRGIAHSGVRAVRTRLELVAIELSEE |
| Ga0190266_104227541 | 3300017965 | Soil | VLREAAGAVGDIKGIASTGLRALRTRLELLAIEVKEEKAWAIRYIVV |
| Ga0184642_10284592 | 3300019279 | Groundwater Sediment | VSRESTGIVGDVKGLASAGLRAVRTRLELLAIELKEEKVW |
| Ga0193716_12016673 | 3300020061 | Soil | VIREATGIVADLKSTVSTGLRAVRTRLELLSIELAEEKA |
| Ga0206350_101142432 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRQVSGIVGDVRGLAATGVRAVRTRLELASIELSEEKA |
| Ga0207663_106045621 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VERESTGLIGDVKGIASTGLRAIRTRLELAVIELTEQKAWAAR |
| Ga0207662_113749982 | 3300025918 | Switchgrass Rhizosphere | VLREATGIVGDVKAIASTGLRAVRTRLELLAIELKEEKAW |
| Ga0207657_103307041 | 3300025919 | Corn Rhizosphere | VIRQVSGIVGDVRGLASTGLRAVRTRLELAVIELTEEKAWIV |
| Ga0207650_114257811 | 3300025925 | Switchgrass Rhizosphere | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKTW |
| Ga0207687_116711441 | 3300025927 | Miscanthus Rhizosphere | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKT |
| Ga0207644_113279441 | 3300025931 | Switchgrass Rhizosphere | VLRQATGIVGDVKGLASTGLRALRTRLELLAIELKEEKAWAARFLMVAAA |
| Ga0207669_100559955 | 3300025937 | Miscanthus Rhizosphere | VIREASNIVGDVRGIAATGVRAVRTRLELLVIELKE |
| Ga0207711_119180811 | 3300025941 | Switchgrass Rhizosphere | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQKAWAARFFVVAVSGLY |
| Ga0207661_105678331 | 3300025944 | Corn Rhizosphere | VIRQVSGIVGDVRGLASTGLRAVRTRLELAVIELTEEKAWIVRFIL |
| Ga0207661_107380883 | 3300025944 | Corn Rhizosphere | MADVDRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKAWAVRFLVVAVAG |
| Ga0207677_111921461 | 3300026023 | Miscanthus Rhizosphere | VIREATSIVGDLKGLAGTGVRAIRTRLELLAIELKEEKA |
| Ga0207703_107451623 | 3300026035 | Switchgrass Rhizosphere | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQKAWAARFFVVAVSG |
| Ga0207639_110249321 | 3300026041 | Corn Rhizosphere | VIRQVSGIVGDVRGLASTGLRAVRTRLELAVIELTEEKA |
| Ga0207648_111761282 | 3300026089 | Miscanthus Rhizosphere | VDRESTGLIGDVKAIASTGLRAIRTRLELAVIELTEQKAWAVRFLVVAVAGLYLVTF |
| Ga0209903_10401903 | 3300026216 | Soil | VTREPTGIVADVKAIASTGLRAVRTRLELLAIELTEEKAWAV |
| Ga0209152_103694822 | 3300026325 | Soil | VPREATGIVGDIKGIASTGLRAVRTRLELIAIELKEEKVWAVRCLIAAVSAVS |
| Ga0209219_11164421 | 3300027565 | Forest Soil | VFREAGGIVGDVKGLATTGLRAVRTRLELLAIELTEEKAWAVRFLL |
| Ga0307280_102373453 | 3300028768 | Soil | VDRESTGIIGDVKGIASTGLRAIRTRLELAAIELSEEKAWAVRFLVVAVAGLY |
| Ga0308189_105544262 | 3300031058 | Soil | VLRQATGIVGDVRGLASTGLRAVRTRLELLAIELKEEK |
| Ga0308197_103762811 | 3300031093 | Soil | VDRESTGIIGDVRGIFSTGLRAVRTRLELVAIELAEEKAWAMRFLVVAVA |
| Ga0308197_103914601 | 3300031093 | Soil | VERQSTGLIGDVKGIASAGLRAVRTRLELAAIELSEEKAWAVRFLVVGIAGLYLL |
| Ga0307498_102710713 | 3300031170 | Soil | VIRESSGLVADIRGIGATGVRAVRTRLELAVIELQEEKARLTR |
| (restricted) Ga0255310_101491811 | 3300031197 | Sandy Soil | VDRESTGIIGDVKGIASTGLRAIRTRLELAAIELSEEKAWAVR |
| Ga0307408_1014088611 | 3300031548 | Rhizosphere | VIREATNIVGDIRGIASTGVRAVRTRLELLAIELKEEKAW |
| Ga0307473_114001812 | 3300031820 | Hardwood Forest Soil | VAREAGGIVGDIKAIASTGLRAVGTRLELLAIELKAEKAWAVRFLIVAVTALYLL |
| Ga0307406_102453761 | 3300031901 | Rhizosphere | VIREATNIVGDIRGIASTGVRAVRTRLELLAIELKEEKA |
| Ga0307407_115536611 | 3300031903 | Rhizosphere | VIREATSIVGDLRGVASTGVRAVRTRLELLTIELKEEKAWLV |
| Ga0307412_115130081 | 3300031911 | Rhizosphere | MTVLRQAGGIVGDLRGIASTSVRAVRTRLELLALELKEEK |
| Ga0307472_1008055041 | 3300032205 | Hardwood Forest Soil | VIREATGIVGDIKGIASTGVRAVRTRLELLAIELKE |
| Ga0307472_1024932852 | 3300032205 | Hardwood Forest Soil | MGVIREATGIVGDVRGLASTGIRAVRTRLELLAIELAEEKAWLV |
| Ga0310896_103213851 | 3300032211 | Soil | VNRESTGLLGDVRGIASTGLRAIRTRLELAAIELSEEKTWAV |
| Ga0335077_102838114 | 3300033158 | Soil | VIRQASGIVGDVRGLAATGVRAVRTRMELASIELAEEKAWLV |
| Ga0310810_110019402 | 3300033412 | Soil | VIRQVSGIVGDVRGLASTGLRAVRTRLELAVIELTEEKAWIVRFILV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |