Basic Information | |
---|---|
Family ID | F105458 |
Family Type | Metagenome |
Number of Sequences | 100 |
Average Sequence Length | 38 residues |
Representative Sequence | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHF |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 86.00 % |
% of genes near scaffold ends (potentially truncated) | 85.00 % |
% of genes from short scaffolds (< 2000 bps) | 86.00 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (29.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 9.00 |
PF05544 | Pro_racemase | 3.00 |
PF01668 | SmpB | 2.00 |
PF08327 | AHSA1 | 2.00 |
PF12847 | Methyltransf_18 | 1.00 |
PF02768 | DNA_pol3_beta_3 | 1.00 |
PF13845 | Septum_form | 1.00 |
PF13180 | PDZ_2 | 1.00 |
PF04294 | VanW | 1.00 |
PF14317 | YcxB | 1.00 |
PF02096 | 60KD_IMP | 1.00 |
PF03989 | DNA_gyraseA_C | 1.00 |
PF00547 | Urease_gamma | 1.00 |
PF07676 | PD40 | 1.00 |
PF01022 | HTH_5 | 1.00 |
PF00999 | Na_H_Exchanger | 1.00 |
PF00753 | Lactamase_B | 1.00 |
PF12840 | HTH_20 | 1.00 |
PF06197 | DUF998 | 1.00 |
PF02518 | HATPase_c | 1.00 |
PF03591 | AzlC | 1.00 |
PF13365 | Trypsin_2 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 3.00 |
COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.00 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 1.00 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.00 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 1.00 |
COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 1.00 |
COG2720 | Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domains | Defense mechanisms [V] | 1.00 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.00 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.00 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.00 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.00 % |
All Organisms | root | All Organisms | 45.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E02HMB24 | Not Available | 517 | Open in IMG/M |
3300001664|P5cmW16_1005417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2381 | Open in IMG/M |
3300005518|Ga0070699_100004443 | All Organisms → cellular organisms → Bacteria | 12400 | Open in IMG/M |
3300005718|Ga0068866_10579246 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300005833|Ga0074472_11294023 | Not Available | 504 | Open in IMG/M |
3300005836|Ga0074470_10799027 | All Organisms → cellular organisms → Bacteria | 28185 | Open in IMG/M |
3300005842|Ga0068858_101621533 | Not Available | 638 | Open in IMG/M |
3300006041|Ga0075023_100524551 | Not Available | 537 | Open in IMG/M |
3300006196|Ga0075422_10446072 | Not Available | 579 | Open in IMG/M |
3300006795|Ga0075520_1319991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 635 | Open in IMG/M |
3300006918|Ga0079216_10252219 | Not Available | 1009 | Open in IMG/M |
3300009029|Ga0066793_10127303 | Not Available | 1484 | Open in IMG/M |
3300009032|Ga0105048_10924428 | Not Available | 759 | Open in IMG/M |
3300009131|Ga0115027_10999406 | Not Available | 655 | Open in IMG/M |
3300009553|Ga0105249_11650615 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300010044|Ga0126310_11382152 | Not Available | 573 | Open in IMG/M |
3300010371|Ga0134125_11320999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 787 | Open in IMG/M |
3300011003|Ga0138514_100106074 | Not Available | 611 | Open in IMG/M |
3300011999|Ga0120148_1028522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1209 | Open in IMG/M |
3300012005|Ga0120161_1130009 | Not Available | 573 | Open in IMG/M |
3300012898|Ga0157293_10014041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1371 | Open in IMG/M |
3300012903|Ga0157289_10128360 | Not Available | 758 | Open in IMG/M |
3300012918|Ga0137396_10896650 | Not Available | 650 | Open in IMG/M |
3300013308|Ga0157375_11404821 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300014052|Ga0120109_1007839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2350 | Open in IMG/M |
3300014271|Ga0075326_1032293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1341 | Open in IMG/M |
3300014298|Ga0075341_1067882 | Not Available | 637 | Open in IMG/M |
3300014301|Ga0075323_1073573 | Not Available | 700 | Open in IMG/M |
3300014317|Ga0075343_1068628 | Not Available | 753 | Open in IMG/M |
3300014494|Ga0182017_10952100 | Not Available | 516 | Open in IMG/M |
3300014839|Ga0182027_11392390 | Not Available | 695 | Open in IMG/M |
3300014874|Ga0180084_1106955 | Not Available | 584 | Open in IMG/M |
3300015077|Ga0173483_10267208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 822 | Open in IMG/M |
3300015371|Ga0132258_11850355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1521 | Open in IMG/M |
3300015373|Ga0132257_101189691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 964 | Open in IMG/M |
3300015374|Ga0132255_105972612 | Not Available | 515 | Open in IMG/M |
3300016445|Ga0182038_10535196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1004 | Open in IMG/M |
3300017787|Ga0183260_10113869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1949 | Open in IMG/M |
3300018061|Ga0184619_10049002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1833 | Open in IMG/M |
3300018073|Ga0184624_10366464 | Not Available | 644 | Open in IMG/M |
3300018422|Ga0190265_12429880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300018476|Ga0190274_10606865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
3300018920|Ga0190273_12058838 | Not Available | 531 | Open in IMG/M |
3300019788|Ga0182028_1006269 | Not Available | 888 | Open in IMG/M |
3300019876|Ga0193703_1072864 | Not Available | 507 | Open in IMG/M |
3300020186|Ga0163153_10314952 | Not Available | 709 | Open in IMG/M |
3300020213|Ga0163152_10086528 | Not Available | 2005 | Open in IMG/M |
3300021081|Ga0210379_10561992 | Not Available | 508 | Open in IMG/M |
3300021339|Ga0193706_1115867 | Not Available | 730 | Open in IMG/M |
3300021510|Ga0222621_1133888 | Not Available | 528 | Open in IMG/M |
3300023058|Ga0193714_1063279 | Not Available | 521 | Open in IMG/M |
3300025764|Ga0209539_1315873 | Not Available | 529 | Open in IMG/M |
3300025796|Ga0210113_1000801 | All Organisms → cellular organisms → Bacteria | 7772 | Open in IMG/M |
3300025899|Ga0207642_10133649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1298 | Open in IMG/M |
3300025901|Ga0207688_10070835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1978 | Open in IMG/M |
3300025912|Ga0207707_10854046 | Not Available | 755 | Open in IMG/M |
3300025922|Ga0207646_10005729 | All Organisms → cellular organisms → Bacteria | 13024 | Open in IMG/M |
3300025936|Ga0207670_11735741 | Not Available | 531 | Open in IMG/M |
3300025938|Ga0207704_10079521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2113 | Open in IMG/M |
3300025953|Ga0210068_1027873 | Not Available | 832 | Open in IMG/M |
3300025960|Ga0207651_10033143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3328 | Open in IMG/M |
3300026095|Ga0207676_12377783 | Not Available | 527 | Open in IMG/M |
3300026329|Ga0209375_1253508 | Not Available | 589 | Open in IMG/M |
3300026450|Ga0247847_1008724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1473 | Open in IMG/M |
3300027423|Ga0207544_100260 | Not Available | 663 | Open in IMG/M |
3300027424|Ga0209984_1030782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
3300027614|Ga0209970_1016159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1245 | Open in IMG/M |
3300027639|Ga0209387_1055635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 882 | Open in IMG/M |
3300027682|Ga0209971_1029392 | Not Available | 1316 | Open in IMG/M |
3300027903|Ga0209488_10744289 | Not Available | 699 | Open in IMG/M |
3300027907|Ga0207428_10546722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 838 | Open in IMG/M |
3300027954|Ga0209859_1053642 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300028381|Ga0268264_10097964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2542 | Open in IMG/M |
3300028770|Ga0302258_1118439 | Not Available | 646 | Open in IMG/M |
3300028819|Ga0307296_10113035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1458 | Open in IMG/M |
3300028824|Ga0307310_10060149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1606 | Open in IMG/M |
3300028878|Ga0307278_10004003 | All Organisms → cellular organisms → Bacteria | 7132 | Open in IMG/M |
3300030339|Ga0311360_11333200 | Not Available | 563 | Open in IMG/M |
3300030511|Ga0268241_10205318 | Not Available | 502 | Open in IMG/M |
3300030943|Ga0311366_10776828 | Not Available | 831 | Open in IMG/M |
3300031231|Ga0170824_102875855 | Not Available | 540 | Open in IMG/M |
3300031232|Ga0302323_101623270 | Not Available | 730 | Open in IMG/M |
3300031235|Ga0265330_10418418 | Not Available | 567 | Open in IMG/M |
3300031554|Ga0315544_1001150 | All Organisms → cellular organisms → Bacteria | 21495 | Open in IMG/M |
3300031751|Ga0318494_10023579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3085 | Open in IMG/M |
3300031769|Ga0318526_10153374 | Not Available | 937 | Open in IMG/M |
3300031798|Ga0318523_10148014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1167 | Open in IMG/M |
3300031832|Ga0318499_10182953 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300031918|Ga0311367_11376783 | Not Available | 695 | Open in IMG/M |
3300031959|Ga0318530_10168796 | Not Available | 893 | Open in IMG/M |
3300032010|Ga0318569_10118823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1203 | Open in IMG/M |
3300032044|Ga0318558_10369949 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300032157|Ga0315912_11576217 | Not Available | 517 | Open in IMG/M |
3300032251|Ga0316198_10744926 | Not Available | 522 | Open in IMG/M |
3300032401|Ga0315275_11057560 | Not Available | 889 | Open in IMG/M |
3300032401|Ga0315275_11296775 | Not Available | 789 | Open in IMG/M |
3300032420|Ga0335397_10153352 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
3300032516|Ga0315273_10603770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1455 | Open in IMG/M |
3300033412|Ga0310810_10778337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 870 | Open in IMG/M |
3300033550|Ga0247829_10809381 | Not Available | 780 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.00% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.00% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.00% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 2.00% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.00% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.00% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.00% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026450 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25 | Environmental | Open in IMG/M |
3300027423 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-10 (SPAdes) | Environmental | Open in IMG/M |
3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_08185160 | 2189573000 | Grass Soil | MFVRTVDDKASDTLVVVSGEGFWTGSSTVPHLHQSPC |
P5cmW16_10054175 | 3300001664 | Permafrost | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQFV |
Ga0070699_1000044433 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQQIAGSCA* |
Ga0068866_105792461 | 3300005718 | Miscanthus Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHF |
Ga0074472_112940232 | 3300005833 | Sediment (Intertidal) | MPVRAVDDKPSDTLVVVSDEGFWTGSSTLPHLHHVHLRAKTDTLGTT |
Ga0074470_1079902725 | 3300005836 | Sediment (Intertidal) | MPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHHH |
Ga0068858_1016215331 | 3300005842 | Switchgrass Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHS |
Ga0075023_1005245511 | 3300006041 | Watersheds | MFVRTVDDKPSDTLVVVSGEGFWTGSSTLPHLHQY |
Ga0075422_104460721 | 3300006196 | Populus Rhizosphere | MPVRAIDDKPSDTLVVVSDEGFWTGSSTLPHLHHFRSRVS |
Ga0075520_13199911 | 3300006795 | Arctic Peat Soil | DKSSDTLVVVSGEGFWTGSSTLPHLHHFFARAAQ* |
Ga0079216_102522191 | 3300006918 | Agricultural Soil | MVAWWIDNKPSDTLVVFSERTLWTRSSTLLHLHQI |
Ga0066793_101273031 | 3300009029 | Prmafrost Soil | MAVRAIDDKSSDTLVVVSGEGFWTGSSTLPHLHHFFALRR |
Ga0105048_109244281 | 3300009032 | Freshwater | MLPMVARPFDDKPSDTLVVDFGRRFWTGSSTLPHLHQTLP* |
Ga0115027_109994061 | 3300009131 | Wetland | MAVRRADDKASDTLVVVPGHGFRTGSSTLPHLHHL |
Ga0105249_116506151 | 3300009553 | Switchgrass Rhizosphere | MPVRAVDDKPSDTLVVVSEEGFWTGSSTLPHLHQPP |
Ga0126310_113821521 | 3300010044 | Serpentine Soil | MPVRTIDDKPSDTLVVVPGEGFWTGSSTLPHLHHNACFTK |
Ga0134125_113209991 | 3300010371 | Terrestrial Soil | MPVRTVDDKASDTLVVVSGEGFWTGSSTLPHLHHTAFSRC |
Ga0138514_1001060741 | 3300011003 | Soil | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQRSISA |
Ga0120148_10285221 | 3300011999 | Permafrost | MPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQHPALW |
Ga0120161_11300091 | 3300012005 | Permafrost | MPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQH |
Ga0157293_100140413 | 3300012898 | Soil | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHHFFA |
Ga0157289_101283602 | 3300012903 | Soil | MPVRAIDDKASDTLVVVSDEGSWTGSSTLPHLHHFDSSCLAPSGSRW |
Ga0137396_108966501 | 3300012918 | Vadose Zone Soil | MFVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQH |
Ga0157375_114048212 | 3300013308 | Miscanthus Rhizosphere | MGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEAPD |
Ga0120109_10078393 | 3300014052 | Permafrost | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQFVSVAVGA |
Ga0075326_10322932 | 3300014271 | Natural And Restored Wetlands | MGARPVDDKPSDTLVEVPGEGLWTGSSTLPHLHHTEHVS |
Ga0075341_10678822 | 3300014298 | Natural And Restored Wetlands | MFVRTVDDKPSDTLVVVSEEGFWTGSSTLPHLHQPPCRRG |
Ga0075323_10735731 | 3300014301 | Natural And Restored Wetlands | MFVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHS |
Ga0075343_10686282 | 3300014317 | Natural And Restored Wetlands | MFVRAVDDKPSDTLVVVSGEGSWTGSSTLPHLHQQLLRVHFV |
Ga0182017_109521001 | 3300014494 | Fen | MVDRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHL |
Ga0182027_113923901 | 3300014839 | Fen | MVGRALDDKLSDTLVVVSGEGSWTGSSTLPHLHHFFAP |
Ga0180084_11069551 | 3300014874 | Soil | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQFPALNVSARGAGSLIEL |
Ga0173483_102672081 | 3300015077 | Soil | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHHFF |
Ga0132258_118503551 | 3300015371 | Arabidopsis Rhizosphere | MPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQHSF |
Ga0132257_1011896912 | 3300015373 | Arabidopsis Rhizosphere | MGAPAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLL |
Ga0132255_1059726122 | 3300015374 | Arabidopsis Rhizosphere | MLPMVARPFDDKASDTLVVGFGSRFWTGSSTLPHLHQIGHV |
Ga0182038_105351962 | 3300016445 | Soil | MGALAVDDKASDTLVVVPGEGFWTGSSTLPHLHQH |
Ga0183260_101138692 | 3300017787 | Polar Desert Sand | MPVRAVDDKPSDTLVVVPGEGLWTGSSTLPHLHQH |
Ga0184619_100490022 | 3300018061 | Groundwater Sediment | MPVRAVDDKASDTLVVVSDEGFWTGSSTLPHLHHN |
Ga0184624_103664642 | 3300018073 | Groundwater Sediment | MPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQYSL |
Ga0190265_124298801 | 3300018422 | Soil | MPVRTVDDKASDTLVVVSDEGSWTGSSTLPHLHHFHMNTV |
Ga0190274_106068651 | 3300018476 | Soil | RVPMPVRAVDDKPSDTLVVVSEEGFWTGSSTLPHLHQTNRP |
Ga0190273_120588382 | 3300018920 | Soil | MFVRAVDDKPSDTLVVVSGYGFWTGSSTLPHLHQLDSSVDLS |
Ga0182028_10062692 | 3300019788 | Fen | MVGRAIDDKSSNTLVVVSGEGFWTGSSTLPHLHHFF |
Ga0193703_10728641 | 3300019876 | Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFIWWLYRATS |
Ga0163153_103149521 | 3300020186 | Freshwater Microbial Mat | MPVRAVDDKSSDTLVVVSDEGSWTGSSTLPHLHHFKPACV |
Ga0163152_100865282 | 3300020213 | Freshwater Microbial Mat | MFVRTVDDKTSDTLVVVSDEGSWTGSSTLPHLHHF |
Ga0210379_105619922 | 3300021081 | Groundwater Sediment | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQHTSV |
Ga0193706_11158671 | 3300021339 | Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFFSAHR |
Ga0222621_11338881 | 3300021510 | Groundwater Sediment | MPVRAVDDKPSDTLVVVSGEGPWTGSSTLPHLHQSS |
Ga0193714_10632791 | 3300023058 | Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHK |
Ga0209539_13158731 | 3300025764 | Arctic Peat Soil | MVGRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHFFAPAARR |
Ga0210113_100080111 | 3300025796 | Natural And Restored Wetlands | MPVRAVDDKPSDTLVVVFGKGFWTGSSTLPHLHHVVRTLAPQAMKR |
Ga0207642_101336491 | 3300025899 | Miscanthus Rhizosphere | MPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHL |
Ga0207688_100708352 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHLFLARH |
Ga0207707_108540462 | 3300025912 | Corn Rhizosphere | MGAPPVDDKPSDTLVVVSGEGFWTGSSTLPHLHHMTRVDANA |
Ga0207646_100057291 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQQIAGSCA |
Ga0207670_117357411 | 3300025936 | Switchgrass Rhizosphere | MGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSTE |
Ga0207704_100795213 | 3300025938 | Miscanthus Rhizosphere | MPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHLYFARHGSR |
Ga0210068_10278731 | 3300025953 | Natural And Restored Wetlands | MFVRTVDDKPSDTLVVVSGEGFWTGSSTLPHLHQH |
Ga0207651_100331434 | 3300025960 | Switchgrass Rhizosphere | MPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHFFLFTA |
Ga0207676_123777831 | 3300026095 | Switchgrass Rhizosphere | MGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEA |
Ga0209375_12535081 | 3300026329 | Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHTFE |
Ga0247847_10087241 | 3300026450 | Soil | MVDRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHF |
Ga0207544_1002601 | 3300027423 | Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFFARHD |
Ga0209984_10307821 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQY |
Ga0209970_10161592 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHHFS |
Ga0209387_10556351 | 3300027639 | Agricultural Soil | MPVRAVDDKASDTLVVVFGEGFWTGSSTLPHLHQSCS |
Ga0209971_10293922 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHLPIQRAV |
Ga0209488_107442891 | 3300027903 | Vadose Zone Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHTRSGKK |
Ga0207428_105467221 | 3300027907 | Populus Rhizosphere | MGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEAPDT |
Ga0209859_10536421 | 3300027954 | Groundwater Sand | MPDRAVDDKASDTLVVVSGEGSWTGSSTLPHLHHFPFECRGGRR |
Ga0268264_100979643 | 3300028381 | Switchgrass Rhizosphere | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLDRNAEA |
Ga0302258_11184391 | 3300028770 | Fen | MPVRAVDDKPSDTLVVVSDEGSWTGSSTLPHLHQHP |
Ga0307296_101130352 | 3300028819 | Soil | MPVRAVDDKSSDTLVVVPGEGSWTGSSTLPHLHQLTFIRY |
Ga0307310_100601492 | 3300028824 | Soil | MPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQHTVLDASVY |
Ga0307278_100040031 | 3300028878 | Soil | MSVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQFTLL |
Ga0311360_113332001 | 3300030339 | Bog | MVGRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHFF |
Ga0268241_102053182 | 3300030511 | Soil | MGVPAVDDKASDTLVVGSGEGFWTGSSTLPHLHHARFVARTG |
Ga0311366_107768281 | 3300030943 | Fen | MVDRAIDDKSSNTLVVVSGEGFWTGSSTLPHLHHFF |
Ga0170824_1028758551 | 3300031231 | Forest Soil | MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLD |
Ga0302323_1016232701 | 3300031232 | Fen | MLPMVARPFDDKPSDTLVVGFGRRFWTGSSTLPHLHQTLR |
Ga0265330_104184182 | 3300031235 | Rhizosphere | MGAWSVDDKSSDTLVVVPGEGFWTGSSTLPHLHQRCPGAP |
Ga0315544_100115020 | 3300031554 | Salt Marsh Sediment | MAVRAIDDKASDTLVVVSGEGSWTGSSTLPHLHHF |
Ga0318494_100235794 | 3300031751 | Soil | MGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPYSGFL |
Ga0318526_101533742 | 3300031769 | Soil | MGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPFSWFL |
Ga0318523_101480142 | 3300031798 | Soil | MGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHRPFSWF |
Ga0318499_101829532 | 3300031832 | Soil | MGARPLDDKPSDTLVVVSGDGFWTGSSTLPHLHQMIQR |
Ga0311367_113767831 | 3300031918 | Fen | VGMLPMVARPFDDKPSDTLVVGFGRRFWTGSSTLPHLHQTLR |
Ga0318530_101687961 | 3300031959 | Soil | MGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHMSPGPE |
Ga0318569_101188232 | 3300032010 | Soil | MGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPFSWL |
Ga0318558_103699492 | 3300032044 | Soil | MGARPLDDKPSDTLVVVPGNGSWTGSSTLPHLHHFR |
Ga0315912_115762172 | 3300032157 | Soil | MLVRAVDDKPSDTLVVVSGEGSWTGSSTLPHLHQPT |
Ga0316198_107449261 | 3300032251 | Sediment | MLGRRIDDKPSDTLVVVFGRRFWTGSSTLPHLHQSEIQHDPV |
Ga0315275_110575601 | 3300032401 | Sediment | MVVRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHQFFVPRRGG |
Ga0315275_112967751 | 3300032401 | Sediment | MDARAVDDKSSDTLVVVPGDGFWTGSSTLPHLHQMKDRDASLLVR |
Ga0335397_101533523 | 3300032420 | Freshwater | MLPMVARPFDDKPSDTLVVDFGRRFWTGSSTLPHLHQTLP |
Ga0315273_106037701 | 3300032516 | Sediment | MPVRAVDDKPSDTLVVVSDEGFWTGSSTLPHLHQPPW |
Ga0310810_107783371 | 3300033412 | Soil | MPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQTPDSVRAV |
Ga0247829_108093811 | 3300033550 | Soil | MGARPVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFVSSHRR |
⦗Top⦘ |