NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105458

Metagenome Family F105458

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105458
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 38 residues
Representative Sequence MPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHF
Number of Associated Samples 99
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 86.00 %
% of genes near scaffold ends (potentially truncated) 85.00 %
% of genes from short scaffolds (< 2000 bps) 86.00 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (55.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.000 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(29.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF07690MFS_1 9.00
PF05544Pro_racemase 3.00
PF01668SmpB 2.00
PF08327AHSA1 2.00
PF12847Methyltransf_18 1.00
PF02768DNA_pol3_beta_3 1.00
PF13845Septum_form 1.00
PF13180PDZ_2 1.00
PF04294VanW 1.00
PF14317YcxB 1.00
PF0209660KD_IMP 1.00
PF03989DNA_gyraseA_C 1.00
PF00547Urease_gamma 1.00
PF07676PD40 1.00
PF01022HTH_5 1.00
PF00999Na_H_Exchanger 1.00
PF00753Lactamase_B 1.00
PF12840HTH_20 1.00
PF06197DUF998 1.00
PF02518HATPase_c 1.00
PF03591AzlC 1.00
PF13365Trypsin_2 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 3.00
COG0691tmRNA-binding proteinPosttranslational modification, protein turnover, chaperones [O] 2.00
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 1.00
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 1.00
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 1.00
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 1.00
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 1.00
COG1296Predicted branched-chain amino acid permease (azaleucine resistance)Amino acid transport and metabolism [E] 1.00
COG2720Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domainsDefense mechanisms [V] 1.00
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 1.00
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 1.00
COG3371Uncharacterized membrane proteinFunction unknown [S] 1.00
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A55.00 %
All OrganismsrootAll Organisms45.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E02HMB24Not Available517Open in IMG/M
3300001664|P5cmW16_1005417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2381Open in IMG/M
3300005518|Ga0070699_100004443All Organisms → cellular organisms → Bacteria12400Open in IMG/M
3300005718|Ga0068866_10579246All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005833|Ga0074472_11294023Not Available504Open in IMG/M
3300005836|Ga0074470_10799027All Organisms → cellular organisms → Bacteria28185Open in IMG/M
3300005842|Ga0068858_101621533Not Available638Open in IMG/M
3300006041|Ga0075023_100524551Not Available537Open in IMG/M
3300006196|Ga0075422_10446072Not Available579Open in IMG/M
3300006795|Ga0075520_1319991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi635Open in IMG/M
3300006918|Ga0079216_10252219Not Available1009Open in IMG/M
3300009029|Ga0066793_10127303Not Available1484Open in IMG/M
3300009032|Ga0105048_10924428Not Available759Open in IMG/M
3300009131|Ga0115027_10999406Not Available655Open in IMG/M
3300009553|Ga0105249_11650615All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300010044|Ga0126310_11382152Not Available573Open in IMG/M
3300010371|Ga0134125_11320999All Organisms → cellular organisms → Bacteria → Terrabacteria group787Open in IMG/M
3300011003|Ga0138514_100106074Not Available611Open in IMG/M
3300011999|Ga0120148_1028522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1209Open in IMG/M
3300012005|Ga0120161_1130009Not Available573Open in IMG/M
3300012898|Ga0157293_10014041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1371Open in IMG/M
3300012903|Ga0157289_10128360Not Available758Open in IMG/M
3300012918|Ga0137396_10896650Not Available650Open in IMG/M
3300013308|Ga0157375_11404821All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300014052|Ga0120109_1007839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2350Open in IMG/M
3300014271|Ga0075326_1032293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1341Open in IMG/M
3300014298|Ga0075341_1067882Not Available637Open in IMG/M
3300014301|Ga0075323_1073573Not Available700Open in IMG/M
3300014317|Ga0075343_1068628Not Available753Open in IMG/M
3300014494|Ga0182017_10952100Not Available516Open in IMG/M
3300014839|Ga0182027_11392390Not Available695Open in IMG/M
3300014874|Ga0180084_1106955Not Available584Open in IMG/M
3300015077|Ga0173483_10267208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium822Open in IMG/M
3300015371|Ga0132258_11850355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1521Open in IMG/M
3300015373|Ga0132257_101189691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi964Open in IMG/M
3300015374|Ga0132255_105972612Not Available515Open in IMG/M
3300016445|Ga0182038_10535196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1004Open in IMG/M
3300017787|Ga0183260_10113869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1949Open in IMG/M
3300018061|Ga0184619_10049002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1833Open in IMG/M
3300018073|Ga0184624_10366464Not Available644Open in IMG/M
3300018422|Ga0190265_12429880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300018476|Ga0190274_10606865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300018920|Ga0190273_12058838Not Available531Open in IMG/M
3300019788|Ga0182028_1006269Not Available888Open in IMG/M
3300019876|Ga0193703_1072864Not Available507Open in IMG/M
3300020186|Ga0163153_10314952Not Available709Open in IMG/M
3300020213|Ga0163152_10086528Not Available2005Open in IMG/M
3300021081|Ga0210379_10561992Not Available508Open in IMG/M
3300021339|Ga0193706_1115867Not Available730Open in IMG/M
3300021510|Ga0222621_1133888Not Available528Open in IMG/M
3300023058|Ga0193714_1063279Not Available521Open in IMG/M
3300025764|Ga0209539_1315873Not Available529Open in IMG/M
3300025796|Ga0210113_1000801All Organisms → cellular organisms → Bacteria7772Open in IMG/M
3300025899|Ga0207642_10133649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1298Open in IMG/M
3300025901|Ga0207688_10070835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1978Open in IMG/M
3300025912|Ga0207707_10854046Not Available755Open in IMG/M
3300025922|Ga0207646_10005729All Organisms → cellular organisms → Bacteria13024Open in IMG/M
3300025936|Ga0207670_11735741Not Available531Open in IMG/M
3300025938|Ga0207704_10079521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2113Open in IMG/M
3300025953|Ga0210068_1027873Not Available832Open in IMG/M
3300025960|Ga0207651_10033143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3328Open in IMG/M
3300026095|Ga0207676_12377783Not Available527Open in IMG/M
3300026329|Ga0209375_1253508Not Available589Open in IMG/M
3300026450|Ga0247847_1008724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1473Open in IMG/M
3300027423|Ga0207544_100260Not Available663Open in IMG/M
3300027424|Ga0209984_1030782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300027614|Ga0209970_1016159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1245Open in IMG/M
3300027639|Ga0209387_1055635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi882Open in IMG/M
3300027682|Ga0209971_1029392Not Available1316Open in IMG/M
3300027903|Ga0209488_10744289Not Available699Open in IMG/M
3300027907|Ga0207428_10546722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium838Open in IMG/M
3300027954|Ga0209859_1053642All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300028381|Ga0268264_10097964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2542Open in IMG/M
3300028770|Ga0302258_1118439Not Available646Open in IMG/M
3300028819|Ga0307296_10113035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1458Open in IMG/M
3300028824|Ga0307310_10060149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1606Open in IMG/M
3300028878|Ga0307278_10004003All Organisms → cellular organisms → Bacteria7132Open in IMG/M
3300030339|Ga0311360_11333200Not Available563Open in IMG/M
3300030511|Ga0268241_10205318Not Available502Open in IMG/M
3300030943|Ga0311366_10776828Not Available831Open in IMG/M
3300031231|Ga0170824_102875855Not Available540Open in IMG/M
3300031232|Ga0302323_101623270Not Available730Open in IMG/M
3300031235|Ga0265330_10418418Not Available567Open in IMG/M
3300031554|Ga0315544_1001150All Organisms → cellular organisms → Bacteria21495Open in IMG/M
3300031751|Ga0318494_10023579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3085Open in IMG/M
3300031769|Ga0318526_10153374Not Available937Open in IMG/M
3300031798|Ga0318523_10148014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1167Open in IMG/M
3300031832|Ga0318499_10182953All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031918|Ga0311367_11376783Not Available695Open in IMG/M
3300031959|Ga0318530_10168796Not Available893Open in IMG/M
3300032010|Ga0318569_10118823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1203Open in IMG/M
3300032044|Ga0318558_10369949All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032157|Ga0315912_11576217Not Available517Open in IMG/M
3300032251|Ga0316198_10744926Not Available522Open in IMG/M
3300032401|Ga0315275_11057560Not Available889Open in IMG/M
3300032401|Ga0315275_11296775Not Available789Open in IMG/M
3300032420|Ga0335397_10153352All Organisms → cellular organisms → Bacteria2268Open in IMG/M
3300032516|Ga0315273_10603770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1455Open in IMG/M
3300033412|Ga0310810_10778337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium870Open in IMG/M
3300033550|Ga0247829_10809381Not Available780Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.00%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat2.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.00%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.00%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.00%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.00%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.00%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.00%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012005Permafrost microbial communities from Nunavut, Canada - A15_80cm_0MEnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014317Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020213Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026450Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25EnvironmentalOpen in IMG/M
3300027423Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028770Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031554Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_081851602189573000Grass SoilMFVRTVDDKASDTLVVVSGEGFWTGSSTVPHLHQSPC
P5cmW16_100541753300001664PermafrostMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQFV
Ga0070699_10000444333300005518Corn, Switchgrass And Miscanthus RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQQIAGSCA*
Ga0068866_1057924613300005718Miscanthus RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHF
Ga0074472_1129402323300005833Sediment (Intertidal)MPVRAVDDKPSDTLVVVSDEGFWTGSSTLPHLHHVHLRAKTDTLGTT
Ga0074470_10799027253300005836Sediment (Intertidal)MPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHHH
Ga0068858_10162153313300005842Switchgrass RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHS
Ga0075023_10052455113300006041WatershedsMFVRTVDDKPSDTLVVVSGEGFWTGSSTLPHLHQY
Ga0075422_1044607213300006196Populus RhizosphereMPVRAIDDKPSDTLVVVSDEGFWTGSSTLPHLHHFRSRVS
Ga0075520_131999113300006795Arctic Peat SoilDKSSDTLVVVSGEGFWTGSSTLPHLHHFFARAAQ*
Ga0079216_1025221913300006918Agricultural SoilMVAWWIDNKPSDTLVVFSERTLWTRSSTLLHLHQI
Ga0066793_1012730313300009029Prmafrost SoilMAVRAIDDKSSDTLVVVSGEGFWTGSSTLPHLHHFFALRR
Ga0105048_1092442813300009032FreshwaterMLPMVARPFDDKPSDTLVVDFGRRFWTGSSTLPHLHQTLP*
Ga0115027_1099940613300009131WetlandMAVRRADDKASDTLVVVPGHGFRTGSSTLPHLHHL
Ga0105249_1165061513300009553Switchgrass RhizosphereMPVRAVDDKPSDTLVVVSEEGFWTGSSTLPHLHQPP
Ga0126310_1138215213300010044Serpentine SoilMPVRTIDDKPSDTLVVVPGEGFWTGSSTLPHLHHNACFTK
Ga0134125_1132099913300010371Terrestrial SoilMPVRTVDDKASDTLVVVSGEGFWTGSSTLPHLHHTAFSRC
Ga0138514_10010607413300011003SoilMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQRSISA
Ga0120148_102852213300011999PermafrostMPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQHPALW
Ga0120161_113000913300012005PermafrostMPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQH
Ga0157293_1001404133300012898SoilMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHHFFA
Ga0157289_1012836023300012903SoilMPVRAIDDKASDTLVVVSDEGSWTGSSTLPHLHHFDSSCLAPSGSRW
Ga0137396_1089665013300012918Vadose Zone SoilMFVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQH
Ga0157375_1140482123300013308Miscanthus RhizosphereMGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEAPD
Ga0120109_100783933300014052PermafrostMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQFVSVAVGA
Ga0075326_103229323300014271Natural And Restored WetlandsMGARPVDDKPSDTLVEVPGEGLWTGSSTLPHLHHTEHVS
Ga0075341_106788223300014298Natural And Restored WetlandsMFVRTVDDKPSDTLVVVSEEGFWTGSSTLPHLHQPPCRRG
Ga0075323_107357313300014301Natural And Restored WetlandsMFVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHS
Ga0075343_106862823300014317Natural And Restored WetlandsMFVRAVDDKPSDTLVVVSGEGSWTGSSTLPHLHQQLLRVHFV
Ga0182017_1095210013300014494FenMVDRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHL
Ga0182027_1139239013300014839FenMVGRALDDKLSDTLVVVSGEGSWTGSSTLPHLHHFFAP
Ga0180084_110695513300014874SoilMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQFPALNVSARGAGSLIEL
Ga0173483_1026720813300015077SoilMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHHFF
Ga0132258_1185035513300015371Arabidopsis RhizosphereMPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQHSF
Ga0132257_10118969123300015373Arabidopsis RhizosphereMGAPAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLL
Ga0132255_10597261223300015374Arabidopsis RhizosphereMLPMVARPFDDKASDTLVVGFGSRFWTGSSTLPHLHQIGHV
Ga0182038_1053519623300016445SoilMGALAVDDKASDTLVVVPGEGFWTGSSTLPHLHQH
Ga0183260_1011386923300017787Polar Desert SandMPVRAVDDKPSDTLVVVPGEGLWTGSSTLPHLHQH
Ga0184619_1004900223300018061Groundwater SedimentMPVRAVDDKASDTLVVVSDEGFWTGSSTLPHLHHN
Ga0184624_1036646423300018073Groundwater SedimentMPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQYSL
Ga0190265_1242988013300018422SoilMPVRTVDDKASDTLVVVSDEGSWTGSSTLPHLHHFHMNTV
Ga0190274_1060686513300018476SoilRVPMPVRAVDDKPSDTLVVVSEEGFWTGSSTLPHLHQTNRP
Ga0190273_1205883823300018920SoilMFVRAVDDKPSDTLVVVSGYGFWTGSSTLPHLHQLDSSVDLS
Ga0182028_100626923300019788FenMVGRAIDDKSSNTLVVVSGEGFWTGSSTLPHLHHFF
Ga0193703_107286413300019876SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFIWWLYRATS
Ga0163153_1031495213300020186Freshwater Microbial MatMPVRAVDDKSSDTLVVVSDEGSWTGSSTLPHLHHFKPACV
Ga0163152_1008652823300020213Freshwater Microbial MatMFVRTVDDKTSDTLVVVSDEGSWTGSSTLPHLHHF
Ga0210379_1056199223300021081Groundwater SedimentMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQHTSV
Ga0193706_111586713300021339SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFFSAHR
Ga0222621_113388813300021510Groundwater SedimentMPVRAVDDKPSDTLVVVSGEGPWTGSSTLPHLHQSS
Ga0193714_106327913300023058SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHK
Ga0209539_131587313300025764Arctic Peat SoilMVGRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHFFAPAARR
Ga0210113_1000801113300025796Natural And Restored WetlandsMPVRAVDDKPSDTLVVVFGKGFWTGSSTLPHLHHVVRTLAPQAMKR
Ga0207642_1013364913300025899Miscanthus RhizosphereMPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHL
Ga0207688_1007083523300025901Corn, Switchgrass And Miscanthus RhizosphereMPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHLFLARH
Ga0207707_1085404623300025912Corn RhizosphereMGAPPVDDKPSDTLVVVSGEGFWTGSSTLPHLHHMTRVDANA
Ga0207646_1000572913300025922Corn, Switchgrass And Miscanthus RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQQIAGSCA
Ga0207670_1173574113300025936Switchgrass RhizosphereMGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSTE
Ga0207704_1007952133300025938Miscanthus RhizosphereMPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHLYFARHGSR
Ga0210068_102787313300025953Natural And Restored WetlandsMFVRTVDDKPSDTLVVVSGEGFWTGSSTLPHLHQH
Ga0207651_1003314343300025960Switchgrass RhizosphereMPVRAIDDKASDTLVVVSDEGFWTGSSTLPHLHHFFLFTA
Ga0207676_1237778313300026095Switchgrass RhizosphereMGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEA
Ga0209375_125350813300026329SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHTFE
Ga0247847_100872413300026450SoilMVDRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHF
Ga0207544_10026013300027423SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFFARHD
Ga0209984_103078213300027424Arabidopsis Thaliana RhizosphereMPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHQY
Ga0209970_101615923300027614Arabidopsis Thaliana RhizosphereMPVRAVDDKASDTLVVVSGEGFWTGSSTLPHLHHFS
Ga0209387_105563513300027639Agricultural SoilMPVRAVDDKASDTLVVVFGEGFWTGSSTLPHLHQSCS
Ga0209971_102939223300027682Arabidopsis Thaliana RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQHLPIQRAV
Ga0209488_1074428913300027903Vadose Zone SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHHTRSGKK
Ga0207428_1054672213300027907Populus RhizosphereMGSPAVDDKASDTLVVVPGEGLWTGSSTLPHLHQSSSEAPDT
Ga0209859_105364213300027954Groundwater SandMPDRAVDDKASDTLVVVSGEGSWTGSSTLPHLHHFPFECRGGRR
Ga0268264_1009796433300028381Switchgrass RhizosphereMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLDRNAEA
Ga0302258_111843913300028770FenMPVRAVDDKPSDTLVVVSDEGSWTGSSTLPHLHQHP
Ga0307296_1011303523300028819SoilMPVRAVDDKSSDTLVVVPGEGSWTGSSTLPHLHQLTFIRY
Ga0307310_1006014923300028824SoilMPVRAVDDKSSDTLVVVSGEGFWTGSSTLPHLHQHTVLDASVY
Ga0307278_1000400313300028878SoilMSVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQFTLL
Ga0311360_1133320013300030339BogMVGRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHHFF
Ga0268241_1020531823300030511SoilMGVPAVDDKASDTLVVGSGEGFWTGSSTLPHLHHARFVARTG
Ga0311366_1077682813300030943FenMVDRAIDDKSSNTLVVVSGEGFWTGSSTLPHLHHFF
Ga0170824_10287585513300031231Forest SoilMPVRAVDDKPSDTLVVVSGEGFWTGSSTLPHLHQLD
Ga0302323_10162327013300031232FenMLPMVARPFDDKPSDTLVVGFGRRFWTGSSTLPHLHQTLR
Ga0265330_1041841823300031235RhizosphereMGAWSVDDKSSDTLVVVPGEGFWTGSSTLPHLHQRCPGAP
Ga0315544_1001150203300031554Salt Marsh SedimentMAVRAIDDKASDTLVVVSGEGSWTGSSTLPHLHHF
Ga0318494_1002357943300031751SoilMGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPYSGFL
Ga0318526_1015337423300031769SoilMGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPFSWFL
Ga0318523_1014801423300031798SoilMGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHRPFSWF
Ga0318499_1018295323300031832SoilMGARPLDDKPSDTLVVVSGDGFWTGSSTLPHLHQMIQR
Ga0311367_1137678313300031918FenVGMLPMVARPFDDKPSDTLVVGFGRRFWTGSSTLPHLHQTLR
Ga0318530_1016879613300031959SoilMGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHMSPGPE
Ga0318569_1011882323300032010SoilMGARPVDDKPSDTLVVVSGDGFWTGSSTLPHLHHPPFSWL
Ga0318558_1036994923300032044SoilMGARPLDDKPSDTLVVVPGNGSWTGSSTLPHLHHFR
Ga0315912_1157621723300032157SoilMLVRAVDDKPSDTLVVVSGEGSWTGSSTLPHLHQPT
Ga0316198_1074492613300032251SedimentMLGRRIDDKPSDTLVVVFGRRFWTGSSTLPHLHQSEIQHDPV
Ga0315275_1105756013300032401SedimentMVVRAIDDKSPDTLVVVSGEGFWTGSSTLPHLHQFFVPRRGG
Ga0315275_1129677513300032401SedimentMDARAVDDKSSDTLVVVPGDGFWTGSSTLPHLHQMKDRDASLLVR
Ga0335397_1015335233300032420FreshwaterMLPMVARPFDDKPSDTLVVDFGRRFWTGSSTLPHLHQTLP
Ga0315273_1060377013300032516SedimentMPVRAVDDKPSDTLVVVSDEGFWTGSSTLPHLHQPPW
Ga0310810_1077833713300033412SoilMPVRAIDDKPSDTLVVVSGEGFWTGSSTLPHLHQTPDSVRAV
Ga0247829_1080938113300033550SoilMGARPVDDKPSDTLVVVSGEGFWTGSSTLPHLHHFVSSHRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.